KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU449Help
Entry
UU449             CDS       T00040                                 

Gene name
ruvA
Definition
holliday-junction binding protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:uur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UU449 (ruvA)
Enzymes [BR:uur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UU449 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(509678..510265)
Genome map
AA seq 195 aa AA seqDB search
MNYLIFKVIYANANIVVGEHNFIGYQIRIPKDYELEINKFCKLYLYEYISIMPNKNLIIK
DLYGFRTYNERLLFIDLISINSIGPKTAINILKYDIDTIIDAIATKNIDYLITIKGINQR
NANLICDQLNYKYINKVNDKNNWAKELSIGLENLGYTKKDIEYAITKVKINSQQDIDISE
IISSAIKEISLRHEN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttaatttttaaagttatttatgcaaatgcaaatattgttgttggcgaacat
aattttattggttatcaaatacgtatcccaaaagattatgaattagaaattaataaattt
tgcaaattatatttgtatgaatatattagcataatgcctaataaaaatttaattattaaa
gatttatatggttttcgtacttataatgaacggttattatttatagacttgattagtatt
aattcaattggcccaaaaacagctattaatattctaaaatatgatattgatacaattatt
gatgcaattgctactaagaatatagattatttaataacaattaaaggaattaaccaacga
aatgctaatttgatttgtgatcaattaaattataaatacataaataaagtaaatgataaa
aataactgagctaaagaattaagtataggtcttgaaaatttaggatatactaaaaaagat
attgagtatgctattactaaagttaaaattaattctcaacaagatattgatattagtgaa
attataagctctgcaatcaaagaaatttcattgcgccatgaaaactaa

DBGET integrated database retrieval system