KEGG   Vibrio alginolyticus: N646_0199Help
Entry
N646_0199         CDS       T02840                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
vag  Vibrio alginolyticus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vag00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:223435..224013
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRFGVGKVSSRIGLQSDAH
LFRQDTNLYQEIAALNEVEKRHCILVDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIKEGDQVAIGGNDKYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcagcaatgaatgcgggtaaatcaacaacgcttctt
caatcctctttcaactatcaagaacgcggcatgacgccagttatttttacggctgcgcta
gatgatcgttttggtgtcggtaaagtgagctctcgtattggtcttcaatctgacgcacat
ttatttcgtcaggataccaatttgtatcaggagatcgcagctctgaatgaggttgaaaaa
cgtcactgtattcttgttgatgagtgtcagttcttgtcgaaagaacaagtttatcaactt
actgaagtcgttgataagttgcatattccagtattgtgttacggccttcgcaccgatttt
ctaggcgaactttttgaaggcagtaagtatctattatcttgggcagacaagctggttgag
ctcaaaacaatctgccattgcggccgcaaagcgaatatggttattcgtaccgatgaacac
ggcgtggcaattaaagaaggcgatcaagttgcgatcggcggtaacgataagtatgtctcc
gtatgccgccaacattacaaagaagcgctcggtaaataa

DBGET integrated database retrieval system