KEGG   Vibrio alginolyticus: N646_1205Help
Entry
N646_1205         CDS       T02840                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
vag  Vibrio alginolyticus
Brite
Enzymes [BR:vag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     N646_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1297408..1297998)
Genome map
AA seq 196 aa AA seqDB search
MKLTKRIICSVVAVIGLVTGGTAVYGPELTQPIGQVVVSERDLGTLRITPKGLKLIGDAE
GCRQNPYVCPGGIPTNGIGNTHGVPDTPITLEQVAIDWVKNIQSAERCVTNAERISGAQM
STGQFDAFTSFVFNFGCTKFRKNKDGSDTRIYEAIKYGNYPKACGHITEWVKSQGVVLKG
LVTRRGLERDRCMEMD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactgactaagcgcatcatttgttctgtagtcgctgtgatcggcttggtaacaggt
ggtacggctgtttatggaccagaattgacgcagcccattgggcaagttgtggtatcggaa
cgagacttaggaacgctgcgcatcacccctaaaggactgaagttgattggtgatgcagag
ggatgccggcagaacccttacgtttgtccgggaggtattcctacgaatggaattgggaat
actcatggtgtgccagatacgccaatcacattggagcaagtcgcgatcgactgggtgaaa
aacattcaatcggccgaacgatgtgtgaccaatgcagaaaggatttcaggagcgcaaatg
agcacgggtcaatttgacgcatttaccagctttgttttcaacttcgggtgtaccaagttt
cgcaaaaataaggacggctctgacactcggatttacgaagcaatcaaatatggcaattat
cccaaagcctgcggtcacattacggagtgggtaaagagtcagggcgttgtgcttaaagga
ctcgtcactcgaagaggattagaacgtgatcgctgcatggaaatggattaa

DBGET integrated database retrieval system