KEGG   Vibrio alginolyticus: N646_1529Help
Entry
N646_1529         CDS       T02840                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vag  Vibrio alginolyticus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vag00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1626869..1628200)
Genome map
AA seq 443 aa AA seqDB search
MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLESIPGYNITPSNDVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTEDARAKL
MEVLDNGKAAECFGKMVAGLGGPADFVENYDNYLEKAEIIKPVYATETGIVSAMDTRAIG
MAVVAMGGGRRVATDEIDYAVGFDEFIRLGEVADSDKPLAVIHARTEEQWEEAAKALRSA
IKVGGEYTPTPEVYRQIRAEDIQ
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccacaagaaatcattcgtaaaaaacgtgacggtgaagtacttaccgcagac
gaaatcaacttctttattcaaggcgtagcgaacaacacggtatctgaaggtcagattgcg
gcgtttgctatgacgattttctttaatgaaatgaccatggatgagcgcatcgccttaacg
tgtgcaatgcgtgattcgggcatggttatcgactggagccacatgaacttcggtggtcca
attgtcgacaaacactcaaccggtggtgtgggtgacgtaacttctttaatgcttggccca
atggtggcagcgtgtggcggtttcgtacctatgatctctggccgcggtcttggtcataca
ggcggtacgctggataaacttgaatctatccctggttacaacattacgccgagcaacgat
gtttttggtcaagtaaccaaagacgctggtgtggcgatcatcggtcaaactggtgacctt
gctcctgcggataagcgtgtttacgcgactcgtgatattaccgcaacggtagacaatatc
tccctgattacggcgtcgatcctttctaagaaactggcggcgggtctggaatcgctagtg
atggacgtaaaagtgggttcaggtgcatttatgccaacttacgaagcgtctgaagagcta
gcaaaatcaatcgttgcggtagcaaacggtgctggcactaagactacggcaattcttacg
gacatgaaccaagtattggcgtcttcagcgggtaacgcagtggaagttcgtgaagcggtt
cgtttcttaacgggtgaataccgtaaccctcgtctacttgaagtgaccatggcttcatgt
gctgaaatgttagtacttggcaagcttgctgagaacacagaagacgcacgcgcaaaactg
atggaagtgctggataacggcaaagcggctgagtgcttcggcaagatggttgctggctta
ggcggtcctgcggacttcgtagaaaactacgacaactacttagaaaaagcagaaatcatc
aagccagtttacgcaacagaaacgggcattgtctctgcaatggatacacgtgctatcggc
atggctgtggttgctatgggtggtggtcgtcgagttgctactgatgaaatcgactacgca
gttggtttcgacgagttcatccgcctaggtgaggtcgcagacagtgataaacctcttgcg
gttatccacgctcgcactgaagagcaatgggaagaagcggcaaaagcactgcgcagtgca
atcaaagtaggtggtgaatacacaccaactccagaggtttaccgccaaattcgtgcagaa
gatatccaatag

DBGET integrated database retrieval system