KEGG   Vibrio alginolyticus: N646_1594Help
Entry
N646_1594         CDS       T02840                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
vag  Vibrio alginolyticus
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N646_1594
Enzymes [BR:vag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N646_1594
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     N646_1594
Glycosyltransferases [BR:vag01003]
 Polysaccharide
  Bacterial polysaccharide
   N646_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1706614..1708986)
Genome map
AA seq 790 aa AA seqDB search
MTDSKKPSAKKAPAKKSTTNKGAAKQTRRTPSKKPTNEKRSWLKVLWSFSWKAGVALAAV
LLFVGIYLDSVVKERFEGQLFELPTVVYARILNLSPGENITIQELRNELDVLNYRKVSQP
RYPGEYSSSSTRIELIRRPFEFADGPEPDRHIMLHFSDSGLQRIQSLESRGDLGYLRLEP
KMLGMLEKDRDEQRLFLRRDQFPEILVDALLATEDRDFYQHDGVSPLAIARALVANIKAG
RTVQGGSTLTQQLAKNLFLTRDKTLWRKVREAYIALILDYRYSKDRILEAYLNEVYLGQS
GGEAIHGFGLASRYYFGQPIQELRIDQLAMLVGMVKGPSYYNPIRYPERTKERRDLVLRL
LMQQNMLTSEQYEQAVSRPLDTQSKPRIASRQPAYFQQLSIELKEKVGERFKAETGLRVF
TSLDPVSQSKMEQAIAKKIPELAKRGGKELEAAAVAVDRHSGEIRAMVGGKRVGYEGFNR
ALNASRPIGSLVKPAIYLTALEQPDKYNLGTTLHDTPLSLKSSKGNVWTPRNYDRKYRGD
VPLYIALAKSLNVPTVRLGMALGIPEVSNTLERLGVNKDEIRPVPSMFLGSFSLTPFEVA
QMYQTLTNSGKRAKLTALRSVMDMEGNVLYQSLPRSSRAVDEQAAWLTTYAMKQGVAQGT
GRFLQSQFGWAALAGKTGTSNDNRDSWFVGVDGREVTTIWLGRDDNKPVNLTGSSGALRV
YAEYLKQRIPERLELPWPREITTLGFKPTSDGGLEMNCRSDYKLPVWDKTGQIKQQCEKK
SNWLNSIFDW
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagcaagaagcctagcgcgaaaaaagcgccagcgaagaaaagtacaaccaat
aaaggagccgcaaaacagactcgacgtacgccgagtaaaaagccgactaacgagaaacgt
tcgtggttgaaagttctgtggtcgtttagctggaaagctggcgttgcacttgccgctgtt
ttgctgtttgttgggatttacttagatagtgtggtgaaagaacgctttgaaggccagctg
tttgagctgccaacggtggtttatgcccgtatcttgaatctaagccctggtgagaatatc
accatccaagaactgcgcaacgagctagatgtgttgaattaccgtaaagtgagtcaacct
cgttacccaggcgaatattcctcttcttccactcggattgaattgattcgtcgtccattc
gagtttgccgatggtcccgagccagatcgtcacattatgctgcatttctctgattccggt
ttgcaacgtattcagtctttagaatctcgaggagaccttggttacttgcgcctagaaccg
aagatgttgggcatgctggagaaagaccgtgatgaacagcgccttttcttacgtcgtgat
cagttccctgaaattttggtggatgcactgcttgcgaccgaagaccgggatttttatcaa
catgacggggtgtcaccgctcgcgattgcacgtgcattggttgcgaacattaaggcgggt
cgtactgttcaaggtggtagtacgctgactcagcaattggcaaaaaacctgtttttgact
cgtgataaaacactgtggcgtaaagttcgagaagcgtatatcgcgctaattttggattac
cgttacagcaaagatcgtatcttagaagcctacctaaacgaagtgtacctaggtcaaagt
ggaggtgaagcgatccacgggtttggcttggcgtcgcgttactattttgggcagccaatt
caggagttgcgaatcgatcaactggcgatgttagttgggatggtaaaaggaccgtcttac
tacaacccaattcgttaccctgagagaacgaaagagcgtcgtgatctcgttctgcgcctg
ttaatgcagcaaaacatgttgacttcagagcagtatgaacaagctgtaagtcgtccactc
gatacgcaaagcaagccacgtattgcgagccgtcagccagcttatttccaacaattgagc
attgaattaaaagaaaaagttggggagcgatttaaagcagagaccggactgcgcgtattt
acgtctctggacccagtatcgcaaagcaaaatggaacaagctatcgcgaaaaagatccca
gaactagctaaacggggtggtaaagagttagaagccgctgctgtggccgttgatcgccat
agtggtgaaatccgtgcgatggttggtggtaaacgtgtcggttatgaaggctttaaccga
gcgctcaatgccagtcgtccaattggttctttagtgaaaccagcgatttacttaacggct
ctagaacaaccggataaatacaacctaggcacgacgctacacgacacgccgttaagtctg
aagagcagtaaaggtaacgtgtggacgccgcgcaactacgatagaaaatatcgtggtgat
gtgccactttacattgctttagcgaaatcacttaacgtaccaaccgtgcgcttaggtatg
gcacttggcattcctgaagtctccaatactttagagcgtttgggcgtgaacaaagacgaa
attcgcccagtgccttcgatgtttttgggttcgttttctttgacgccattcgaagtcgca
cagatgtatcagactctgacgaattcaggtaagcgtgcaaaactgaccgctctgcgctca
gtcatggatatggaaggtaatgtgctgtatcaatccttgcctcgttcatcaagagccgtg
gatgaacaagctgcatggctaacgacctacgcgatgaaacaaggggttgctcaaggcact
ggccgcttcttacaaagccagtttggttgggctgcattggcaggaaaaacgggtaccagt
aatgacaaccgcgatagttggtttgtcggtgttgatggtcgggaggtgacgacaatttgg
ctaggccgcgacgataataaacccgtgaatctaacggggtcgagtggtgcattacgagtg
tacgcagagtacttgaagcagcgtattcctgagcgcttagagctcccatggccaagagaa
atcaccacattagggttcaagcctacatctgatggaggtttagaaatgaactgccgtagt
gattacaaactgccggtttgggataaaaccggtcagataaagcaacagtgtgagaagaaa
tcaaactggttaaatagcatatttgattggtag

DBGET integrated database retrieval system