KEGG   Vibrio alginolyticus: N646_2198Help
Entry
N646_2198         CDS       T02840                                 

Definition
periplasmic alpha-amylase precursor
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
vag  Vibrio alginolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vag00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2377169..2379253)
Genome map
AA seq 694 aa AA seqDB search
MKKTILALSIGLLSACSQIPENAIVLNVGDDTAVFEENSQGLLVAEQKLEKGSYTFTIAD
SKQSCGSSFALAEEDRIKFNRPLKMDNCATDAQMPLRIFKANTYQFTLNPTTNELTVKIK
PKQSQDITYSCPVATDTPKTINVAQTFNDGTVVRDALTEQETTVANGSVTMQPGPMSQGL
LLLEEVEQQADKPFSWDNATVYFVMTDRFYNGNPDNDNSYGRSKDGKYEIGTFHGGDLAG
LTKKLDYIESLGVNAIWITSPLEQIHGWVGGGDKGDFKHYGYHGYYHQDWTKLDANMGTE
DELRAFIDTAHKKGIRVVWDVVMNHTGYATLADMQEFGFGQLYLDDQEAKEVLGEKWTDW
QPKSGQSWHSFNDYIKYGDSEAWDKWWGKDWIRTDIGDYDAPGYNDITMSLNYLPDLKTE
STQKTGLPNFFHNKDTNAQNELQTPREHLITWLSEWVRDYGIDGFRVDTAKHVEMEAWAE
LKASTTQALAQWKQNNPNKALDDLPFWMTGEVWAHSVVKSPYFDNGFDSIINFEFQSDVA
PKALKCFAQLDNDYRRYAERINTDPEFNVLSYLSSHDTQLFWSARSRSFDDQARAANALM
LAPGAVQIYYGDEIARDFGITGSDAHQGTRSDMPWDKIHGEREDLLQHWQKLGEFRKRHP
AVAQGKHITRNQEGYYAFERQYQDDKVLIVYTGE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaattctcgcactctctatcggtctactgagcgcctgcagccagatacca
gaaaatgccatcgtattaaacgttggtgatgacaccgctgtttttgaggaaaactcacaa
ggcttacttgtcgctgagcaaaaactcgaaaaaggcagttatacctttaccattgctgac
agcaagcaaagctgtggcagtagctttgccctagcagaagaagatcgcatcaaattcaat
cgtccattaaaaatggataattgcgccactgatgcacaaatgccgctgcgcatcttcaaa
gccaatacctatcaatttacgctcaatccaaccaccaacgaactgacggtaaaaattaaa
ccaaaacaaagtcaggacatcacctactcttgccctgtcgcaactgacacgccaaaaacc
atcaacgttgctcaaacttttaatgatggcactgtcgttcgtgatgccttaaccgaacaa
gaaaccactgtcgccaatggcagcgtcaccatgcaaccgggtcctatgagccaaggtcta
ttgctgctagaagaagttgaacagcaagccgacaaaccgttcagttgggacaatgcgacg
gtgtacttcgtcatgaccgaccgcttctacaatggcaatccagacaacgacaacagctac
ggtcgcagcaaagacggaaaatatgagattggtaccttccacggtggtgacttagcgggt
ctgacgaaaaaactcgattacatcgaatcacttggtgtcaatgctatctggataacctca
ccactggaacaaatccacggctgggttggcggcggcgataaaggcgactttaagcactac
ggctaccacggctactaccaccaagattggaccaagcttgatgccaacatgggtaccgaa
gatgagctgagagccttcatcgataccgcccacaagaaaggcatccgtgtagtctgggat
gtggtcatgaaccatactggctacgccacattagcagacatgcaggaattcggctttggt
cagctttaccttgatgaccaagaagctaaagaagtcctcggtgaaaaatggaccgactgg
cagccaaaatcaggacaaagctggcatagcttcaacgactatatcaaatacggtgatagc
gaagcgtgggataaatggtggggcaaagactggattcgcaccgacattggcgactacgat
gctccgggctacaacgacatcaccatgtctttgaactacctaccggatctaaaaaccgaa
tcaactcaaaaaaccggattaccaaacttcttccacaataaagacaccaatgcgcaaaat
gagctgcaaaccccgcgtgaacacctgattacctggttatccgagtgggtgcgcgactac
ggcattgatggcttccgtgtcgacactgccaaacacgttgaaatggaagcgtgggcagag
ctgaaagccagcaccacccaagcgcttgctcaatggaagcaaaacaacccgaacaaagcc
ttggatgacctacctttctggatgacaggtgaagtgtgggcacacagcgtggtgaagagt
ccgtatttcgataacggcttcgattccatcatcaactttgagttccaatctgatgtagca
ccaaaagcgctgaagtgtttcgctcaacttgataatgattaccgccgttatgcagaacgc
atcaataccgatcctgagttcaacgtgttgagctacctgtcttcacacgatacacagctg
ttttggtcagcgcgcagccgcagctttgatgaccaagcacgtgcagcgaatgcactgatg
ctggctcccggtgcagtacagatctattacggtgatgagatagctcgtgattttggcatt
actggttcagacgcccaccaaggcacacgctcagatatgccatgggataagattcatggc
gagcgtgaagatctgctgcaacattggcaaaagttgggtgaattccgtaaacgccaccca
gcggttgctcaaggtaagcacatcactcgcaatcaagaaggttactacgcgttcgaacgc
caataccaagacgacaaggtgctgattgtttacaccggtgagtaa

DBGET integrated database retrieval system