KEGG   Vibrio alginolyticus: N646_2377Help
Entry
N646_2377         CDS       T02840                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vag  Vibrio alginolyticus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vag03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2570170..2570979
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRMGISPHMVGQTILSFTFRTPKLRWDIPTELKKLEGQVIRAISRRAKYLL
IETNTGTAIVHLGMSGSLRVLDADFPPAKHDHVDLKLSSGKILRYNDPRRFGAWLWCAPG
ESHAVLANMGPEPLTEEFNAEYVAEKAKNKRVAVKQFIMDNKVVVGVGNIYANESLFKSR
IHPSRPAGKLTSQEWRLLVENIKMTLEIAITQGGTTLKDFAQADGKPGYFAQELLVYGKA
GEPCPECGERLQELKIGQRNTFFCSECQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgccagaagttgaagtgagccgtatggggattagcccccacatggttgga
caaacgatcctgtcgtttacttttcgaacgcctaaattgcgctgggatattcctacagag
cttaaaaaattggaagggcaggtgatccgtgcgattagccgtcgtgcgaaatacttactg
atcgagacaaacacaggtacagccattgttcacttgggcatgtctgggtctttacgtgtc
ctagatgctgactttccgccagcaaagcacgatcatgtggatctcaaactaagcagtgga
aaaatactgcgttataacgatccgcgtcgttttggggcatggctgtggtgtgctcctggc
gagtcacatgctgtgctagcaaacatggggcctgagcctttaactgaagagttcaatgcg
gaatatgtagcggagaaagctaaaaataagcgtgtcgccgtcaagcagttcatcatggac
aacaaagtcgtggttggtgttgggaacatctacgcgaatgagtcgttgtttaaatctcga
attcacccttcaaggcccgcaggtaagttgacttctcaagagtggaggttacttgttgaa
aatatcaaaatgacacttgagattgccattacgcaaggtgggactactctgaaagatttt
gcgcaagccgatggaaagccgggttactttgcacaagagttattggtttacggaaaagca
ggagagccatgcccagagtgcggcgaacgacttcaagagctaaagattggccaacgtaat
accttcttttgtagtgagtgtcagaagtaa

DBGET integrated database retrieval system