KEGG   Vibrio alginolyticus: N646_2829Help
Entry
N646_2829         CDS       T02840                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vag  Vibrio alginolyticus
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    N646_2829
  Amino acid metabolism
   00330 Arginine and proline metabolism
    N646_2829
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    N646_2829
Enzymes [BR:vag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     N646_2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3065087..3066226
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSIVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLEDR
ERFLNARDTINALVANDIVPIVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRRDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSAEPQGTRFLPCAEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNAHGKLVARGISAYSSDDLTKITGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaaatgcagttgtttcacaaccacaaactgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcactctggcactcgaccgtgcacacatggttgagtta
gcacgccagtgtgctgagcttaaaaaacaaggccattcaatcgtaatggtttcgtctggt
gcgattgcagcaggccgtgagcatcttggttaccccgcattgcccaacgagatggcgagt
aagcagttacttgccgcggtggggcagagtcgcttgattcaaacatgggagtctttgttt
ggtatttatggtatcaagatcggccaaatgctactaacccgtgccgatttagaagatcgt
gagcgattccttaacgcgcgtgacactattaatgcgctcgttgcgaacgatattgttcct
atcgtaaacgaaaatgatgccgttgcgactagcgagattaaagttggcgataacgacaac
ctttccgctttggtaggcattttatgtggtgcagataagctcttgcttttaacggaccaa
aaaggtctgtttactgctgaccctcgtagagatccgaacgcagagcttatcaaggaagta
aaaaccatcgacgatacgctgcgtaaaatcgcaggtggaagcggtacaacattgggtact
ggtggtatggcaacgaagctgcaagccgcagacatcgctcgccgcgcaggtatagaggtt
attattgctgctggtagtgcgccgaatgttatctttgactctttaagtgctgaacctcag
ggcacgcgcttcctaccttgcgctgaagccttagagaaccgtaaacgctggattctagcg
ggacctgcggcatcgggcgacatcattattgatgatggtgcagtcaatgctgtggtcggc
aagggcagtagcctacttgctaaaggggtcatcaaagttagtggtgacttcgcacgaggc
gaagtggcgcgtgtaacaaacgctcacggtaagttggtggctcgtggcatcagcgcctac
tcaagtgatgacctaactaaaattacgggtaagcacagtaaagatatcatctctattttg
ggtcatgattatggctctgaggtgattcaccgcgatgatttggtcgtcattcaggaatag

DBGET integrated database retrieval system