KEGG   Vibrio alginolyticus: N646_2829Help
Entry
N646_2829         CDS       T02840                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vag  Vibrio alginolyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vag01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vag00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3065087..3066226
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSIVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLEDR
ERFLNARDTINALVANDIVPIVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRRDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSAEPQGTRFLPCAEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNAHGKLVARGISAYSSDDLTKITGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaaatgcagttgtttcacaaccacaaactgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcactctggcactcgaccgtgcacacatggttgagtta
gcacgccagtgtgctgagcttaaaaaacaaggccattcaatcgtaatggtttcgtctggt
gcgattgcagcaggccgtgagcatcttggttaccccgcattgcccaacgagatggcgagt
aagcagttacttgccgcggtggggcagagtcgcttgattcaaacatgggagtctttgttt
ggtatttatggtatcaagatcggccaaatgctactaacccgtgccgatttagaagatcgt
gagcgattccttaacgcgcgtgacactattaatgcgctcgttgcgaacgatattgttcct
atcgtaaacgaaaatgatgccgttgcgactagcgagattaaagttggcgataacgacaac
ctttccgctttggtaggcattttatgtggtgcagataagctcttgcttttaacggaccaa
aaaggtctgtttactgctgaccctcgtagagatccgaacgcagagcttatcaaggaagta
aaaaccatcgacgatacgctgcgtaaaatcgcaggtggaagcggtacaacattgggtact
ggtggtatggcaacgaagctgcaagccgcagacatcgctcgccgcgcaggtatagaggtt
attattgctgctggtagtgcgccgaatgttatctttgactctttaagtgctgaacctcag
ggcacgcgcttcctaccttgcgctgaagccttagagaaccgtaaacgctggattctagcg
ggacctgcggcatcgggcgacatcattattgatgatggtgcagtcaatgctgtggtcggc
aagggcagtagcctacttgctaaaggggtcatcaaagttagtggtgacttcgcacgaggc
gaagtggcgcgtgtaacaaacgctcacggtaagttggtggctcgtggcatcagcgcctac
tcaagtgatgacctaactaaaattacgggtaagcacagtaaagatatcatctctattttg
ggtcatgattatggctctgaggtgattcaccgcgatgatttggtcgtcattcaggaatag

DBGET integrated database retrieval system