KEGG   Vibrio alginolyticus: N646_2958Help
Entry
N646_2958         CDS       T02840                                 

Definition
endoglucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vag  Vibrio alginolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N646_2958
Enzymes [BR:vag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     N646_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3203968..3204975
Genome map
AA seq 335 aa AA seqDB search
MEQGRVVDGSDERMITTSEGQSYALFFALVANDPKTFDQVLKWTQSHLAGGDLTARLPAW
LWGRKENGQFGVLDSNPASDSDLWIAYSLVEAGRLWNNYYYQTLGHLIASRILREETVNI
AGVGTVLLPAPTGFDADGQYRVNPSYVPLQLIARMQSLYPQYNWDSMYKASVHMLEKTMP
AGFSPDWATLRNGRYSSDVVTGPMGSYNAIRTYLWAGMLNDQVSEKAVLVQKMQPFVAAT
KAVGAPAREVNTETGKYTQAGSAGFSAAALPLLAASGESALLETQFRRAQNELVVDKNDH
YYDNVLSLFGLGWHEERYRFGVQGELLPVRSERCQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaggccgagtcgttgatggcagtgacgagcgtatgattacaacctcggaaggc
caatcttacgcattgttctttgccttggttgccaatgaccctaaaaccttcgatcaggtt
ttaaaatggactcaatcacatttggctggtggggatttgacggcaaggcttcctgcttgg
ttgtggggaagaaaagaaaatggtcagttcggagtcttggattctaacccagcgtcagat
tctgatttgtggatagcttactcccttgttgaggcggggagattatggaataactactac
tatcagacccttggacatctgatcgcgagtcgtattttacgtgaagaaaccgtcaacata
gcgggagttggaacggtattgttgccagctccaacgggctttgatgccgacggccagtac
cgtgtgaatccgagttatgttccgttacaactgattgctcgtatgcagtcgctgtacccg
caatacaactgggactcaatgtataaggcaagtgttcacatgctagagaaaacgatgcca
gcaggctttagcccagactgggcaacattgagaaatggtcgttatagctcagatgtggtt
acagggccgatgggcagttacaacgcgatccgcacttatctttgggcgggtatgctaaat
gaccaagtttcagaaaaagcagtattagtgcaaaaaatgcagccgtttgtcgcggcaacc
aaagccgttggtgcgccagcgagagaagtaaatactgaaacgggtaaatatacccaagca
ggaagcgcaggtttttctgctgcggctcttccgttactcgcggcttctggtgaatctgcg
ctgttggagacgcagtttcgtcgtgctcaaaatgaacttgtggtggacaaaaacgatcat
tattacgacaacgtattaagtctatttgggcttggttggcatgaagaacgttaccgtttt
ggtgtgcaaggtgaattgcttcctgtacggagcgagagatgtcagtaa

DBGET integrated database retrieval system