KEGG   Vibrio alginolyticus: N646_3341Help
Entry
N646_3341         CDS       T02840                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vag  Vibrio alginolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N646_3341
Enzymes [BR:vag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     N646_3341
Exosome [BR:vag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N646_3341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(277518..279713)
Genome map
AA seq 731 aa AA seqDB search
MKITKTKKIKKKHERAYELLAEAAYSDPFAALGPFIDDGEGSLRVWMPGANKVELLVNGE
PRVALERDGDSGFILKEQRDLHLTHYRLAVDWNGVEQIIDDPYQYHNIYQEYEHLHTPKD
MYHYMGAHFVTLERGGENISGVRFLVYAPHASAVSLVGCFNQWDGRRHPMQRLDYGIWGL
FIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQYPSFASITYDHKRYQWQDAKWQNR
AVTQKRDEALSFYELHAGSWKRDEKGDFLNYRELAEQLVPYLVDMGYTHVELMPVSEHPF
YGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGT
PLFHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLD
YSRSHDQWVPNVDGGNENYDAIATLKWMNEEVYKHFPNAMTIAEESTAFPGVSAPTFMGG
LGFGFKWNMGWMHDSLSYIKEDPVHRKYHHNTITFPLVYAHSENYVLSLSHDEVVYGKGS
IHNKMPGDEWQQTANLRAYYGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLEYERH
QGVQKLMRDLNHLYRNEAAMHDQDCVPAGFEWRLQDEADASILAHERISKEGERILIITN
FTPVPHERFRLGVPNAGQYELLLNTDDSKYGGSDFKVLTSVKTEKVESESLPQSLELRLP
PLSTVFYKLHK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatcaccaaaacaaagaaaataaagaaaaaacacgaacgcgcgtacgaactgctt
gctgaggcggcttactcagatccatttgcggcgttgggcccattcattgatgacggcgaa
ggttcgctgcgagtgtggatgccaggcgcaaacaaggttgaactgcttgttaatggtgaa
cctcgcgtggcgcttgaacgcgatggcgacagcggttttatcttaaaagagcaacgcgac
ttacacctgacccactaccgtttagcggtcgattggaatggtgttgaacaaattattgat
gacccgtaccagtaccacaatatctaccaagagtacgagcatctgcatacgccaaaagac
atgtatcactacatgggcgcgcactttgtcacgctagaacgtggcggtgaaaacatttcc
ggtgttcgtttccttgtctacgctccacatgcatcggctgttagccttgtgggttgcttt
aaccaatgggatggtcgtcgtcacccaatgcaacgtttagattatggcatttggggtttg
ttcattcctggtttagaagaaggcgttcagtacaaatttgagctcaaagggccaaatggg
gaagggctgccacacaaacaagacccttggggtttctactctgagcaatacccatcgttc
gcatccattacttacgatcacaagcgttaccaatggcaagatgcgaagtggcaaaaccgc
gcagtgacacaaaagcgtgatgaagcgctatcgttttatgagctgcatgctggatcatgg
aaacgcgacgagaaaggtgatttcctcaactaccgcgaactcgcggagcagttggtgcca
taccttgtggatatgggctacacccacgttgagctgatgcctgtgtctgagcatccattc
tatggttcatggggctatcaacccgttggcttatttgcgccaaccagccgttacggctct
cctgatgatttcaaattcttcgtggatgcgtgtcaccaagctggtatcggtgtggtgctg
gattgggttccggcgcacttcccatcggatgaccacggtttagcaaactttgacggcaca
ccgttgttccacgacccggacccgcgtcgcggttggcaccaagattggaactcatacatc
tatgatttaggccgtgaacatgtgcgtcgcttccttgtatcgaatgcgctgtactggttt
gaacaattccatattgatggcattcgcgtggacgcagtcgcatcgatgctttacctcgac
tactcacgtagccacgatcagtgggtaccgaacgtcgacggtggcaatgaaaactacgac
gcaatcgcaaccttaaaatggatgaacgaagaagtgtacaagcacttcccgaatgcgatg
acgattgcggaagagtcaacggcgtttcctggggtgtctgcgccaacctttatgggtggt
ttaggttttggcttcaagtggaatatggggtggatgcacgacagtctttcatacatcaaa
gaagatcctgttcaccgcaaataccaccacaataccatcacattcccgctggtttatgcg
cacagcgagaactacgtcttgtctctctctcacgatgaggtggtgtacggcaaaggctct
atccataacaagatgccgggtgatgaatggcagcaaaccgcaaacctacgtgcatactac
ggttacatgtatggtcaaccgggcaaaaagctgaacttcatgggcgcggaaatcggccaa
acggcggagtggaaccacgatgatcagttgcaatggttcttgctggaatatgagcgtcat
caaggtgtccaaaagctgatgcgagatttgaaccacttgtaccgaaatgaagcggcgatg
cacgatcaagattgtgttcctgctggttttgagtggcgtctacaagacgaagcggatgcg
agcatcctagcgcacgagcgtattagtaaagaaggtgagcgtattctgatcatcaccaac
tttacgcccgtaccacacgagcgctttcgtttaggcgttccaaatgcaggtcaatacgaa
ctgctactgaatacagacgacagcaaatacggcggcagcgattttaaagtgctgaccagt
gtgaaaacggaaaaagttgaaagtgaatcactgcctcaatcacttgagcttcgtttgcct
ccactttcaaccgtgttctacaagctgcacaaataa

DBGET integrated database retrieval system