KEGG   Vibrio alginolyticus: N646_3342Help
Entry
N646_3342         CDS       T02840                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vag  Vibrio alginolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N646_3342
Enzymes [BR:vag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     N646_3342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(279981..282161)
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEAKVSEETLRRLLASLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQDDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARDSHWVNYTEVSQLKMSVLPLLFSEFK
ARHLDKNTDRARAFLDFVEKGGDSLLHQAAFDALHADLHAEDANMWGWPVFPEKYRTFDA
AGTQKYIKDNQDRVHLYMYLQWIADDQIKEAQALAEEKGMAVGLYRDLAVGVADSGSETW
ADEGNLVLDASIGAPPDILGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEKQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcggaaatggcgagattggctgatagctat
gtcagtgcttggggagatgaggcgaaagtgtctgaggagacgctacgccgcttgctcgct
tcgcttggctacgatactagcagtgatgaaaaactactggcttctgctgaaaagaaacat
aaaaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtcccaaattgttcgtgatgagcgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcttggggttatcacaaactgatcatc
agtcgtaagcgtcgtaaaacaccttacgagatgtcattgatcattacgccgaaagcgtgt
ttcaaacaagacgatctaaaccaacacaaaaagctatggggtcctagtatccagctttac
acactgcgtactcagcataactggggcatcggtgattttggcgacctaaaacaactggtg
agtgatattgcctctcgtggcggtgacttcattggcttgaaccctattcactcgctgttc
cctgcgaatccagaaggggcaagcccatacagcccgtcttctcgtcgttggttgaacatc
atgtacatcgatgtaagctctgtacctgagttcgcgctaagtgcagaagcacaacaacgt
gttggtagcgcagagttccaacaacgtctacaaaaagcgcgagactctcattgggtgaat
tacaccgaagtttcgcaactaaaaatgagtgttcttccgctgctattcagtgagtttaaa
gctcgccatttagacaagaacaccgatcgcgctcgtgccttcttggactttgttgaaaaa
ggcggcgacagcttgctacaccaagctgcattcgatgcacttcatgctgatttacatgca
gaagatgcaaacatgtggggctggccagtattccctgagaaataccgcacattcgacgca
gctggtactcagaagtacatcaaggacaaccaagatcgcgttcacttgtacatgtaccta
caatggatcgcagacgatcaaatcaaagaagcgcaagctctagcagaagaaaaaggcatg
gcggttggtctgtaccgcgaccttgctgtaggtgttgcagattctggcagtgaaacatgg
gcggatgaaggcaacctagtgctggatgcaagcatcggtgcgccaccagatattcttggc
cctctaggtcaaaactggggtctgccaccgcttaaccctcaagtgttggaagcgacaggc
tacgatgcgtatatcaagttgctacgtgccaacatgaagcattgtggcgcactgcgtatc
gaccacgtacttggcctattgcgtctatggtggattccaaaaggcgagaaagcgacagaa
ggcgcgtacttgtactacccagtggaagacatgctcgcaatcctagcgcttgagtcgcac
cgtcatcagtgctctgtgattggtgaagacttaggtactgtaccagatgaaatcgttgat
atcctacgtgatgcgggcgtgcattcgtacaaagtcttcttcttcgaaacctcaaaagag
gacggcggctttatttctccgaagcattacgcagagcagtctatggcggcattgtgtaca
cacgacatgccaaccctacgcggtttctggcactgcgatgacttgaaaatgggtcgtgag
attggtctgtacccagatgaaaaacagttggaaggcttattcgctgaccgcttgaagtgc
aaacaaggtatcctagacagtgttcgttggcacggttacttgccagaaggtattggccat
gatgcgcagttcgtaccaatggattcatacctaagcgaagcgcttcaattgcacgttgcg
gcgggtgattctgcactgcttagcgttcagcttgaagactggctagaaatggatcaaccg
gtcaacattcctggcacggttgatgagtatccaaactggcgtcgtaagctgtcgatgaac
ctagatgaaatcttcagtcgtgaagacgtgaatcgcatttctaaacgccttacagaagtt
cgcgcacaggcgagcaaataa

DBGET integrated database retrieval system