KEGG   Vibrio alginolyticus: N646_4092Help
Entry
N646_4092         CDS       T02840                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vag  Vibrio alginolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N646_4092
Enzymes [BR:vag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     N646_4092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1102671..1103588
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDITGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTAE
AIEPDLERIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILNPAPARELSDELLSYIDV
ITPNETEAEVLTGITVTDNESAQEAANVLHGKGIEIVMITLGAKGVWLSQNGRGEIISGF
RVEATDTTAAGDTFNGAFVTGLLEGLPLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgcccaggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaaa
ggtgccaaccaagccgtcgcggcggcgcgattaaatgcagacatcggttttatcgcttgt
gtgggcgacgactcattcggcattaacattcgcgaaaacttcaaaatggacggcatcgat
atcactggtgtgaagatgcagccaaattgcccgacaggtatcgcgatgattcaagtgtcg
gacagtggggagaacagcatttgcatttcagctgaagcgaacgccaaactgacagcagaa
gcgattgagccagatttagagcgtattcgccaagcagattacttgctaatgcaattggaa
acgccgatgtgcggcattgagaaagctgcgcgtgtagcgaaagatgccaaaaccaatgtc
attctgaacccagcgccagctcgtgaattgtcagatgaattactgtcttacattgacgtg
attacgccaaatgaaacggaagctgaagttctgacaggtattactgtaacagacaacgaa
agcgcgcaagaagcggcgaatgtgctacatggtaaaggtatagaaattgtcatgatcaca
ctcggtgcaaaaggcgtttggctaagccaaaacggtcgaggcgaaatcatctcgggtttc
cgcgttgaagcgacggatactaccgcagcgggcgatacatttaatggggcattcgtcact
ggtctcctagaaggtttacctttagaatcagcgattaagtttgcacatgcggcggctgca
atttctgtgacccgctttggcgcgcaaacgtcgattccaacccgcgaagaggtggacgcg
tttctcgctgaacaataa

DBGET integrated database retrieval system