KEGG   Vibrio alginolyticus: N646_4138Help
Entry
N646_4138         CDS       T02840                                 

Definition
putative delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vag  Vibrio alginolyticus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    N646_4138
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    N646_4138
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     N646_4138
Lipid biosynthesis proteins [BR:vag01004]
 Desaturase
  First
   N646_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1167630..1168754)
Genome map
AA seq 374 aa AA seqDB search
MTQNKPPVIWLNTLIFSASFVLTFIVMPWYAYHFGLGWEHLIWGVIAFSFTNLSITAGYH
RLWSHKTYEAHPILRAIFAIGGAFSLQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWY
SHIGWMLRDYNKSKENEYTNCRDLKRDKIVMWQHKYYVPLALLTNIGFPVMLGLIYGDIW
GMLLVVGAARLFMSHHTTFFINSLAHIWGKQTFTDKNTARDNGVLAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTPTFRIEKARASQLLKKAREKLESK
PNTQTILDQLQHEFDTLVHHMQEYYEMRKEVLGAKTASVVKKYECSVTKMKYQQIKAEFE
RQQRSWNLMVRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaaaacaaaccacctgttatctggttgaatacattaatattttctgccagtttt
gttctaacttttattgtaatgccttggtatgcatatcattttggactgggttgggaacat
ctaatttggggagtgattgcatttagttttactaacctttctattacagcaggctatcat
cgtctctggagccacaaaacatacgaagctcatcctattttgcgcgccatttttgcgatt
ggaggagcattttctttgcaaaatagtgcattacattggtcttctgatcatcgtgtgcat
cacaaacatgtcgacaataacgataaagatccgtactcagccaagcggggtttttggtat
tctcacattgggtggatgttacgtgattacaataaatcaaaggaaaacgaatatacaaac
tgccgtgacctaaagcgcgacaaaatcgtcatgtggcagcataagtattatgttccactt
gccctactgactaatattggtttcccagtcatgctcggactgatctacggtgatatctgg
gggatgttattggtcgttggtgcggctcgactctttatgagtcaccatacgacttttttc
attaactccctcgcacatatttggggtaagcaaactttcacagacaaaaacactgctcgc
gataatggtgtactcgcctttttcacatttggagagggttaccataatttccatcatatt
ttcgagaatgactatcgcaatggcgtgtattggtggcattacgacccaacgaagtggttg
ataaagtcatgttcttggctaggactcacatctaagttgcgcacaacgcctacatttaga
attgaaaaagcccgtgcgagtcaacttttgaagaaagcaagagaaaagctagaatcgaaa
ccgaacacgcaaacaatcctcgatcagctacagcacgagtttgatactttagttcatcac
atgcaggaatactacgagatgcgcaaagaagtactcggtgccaaaactgccagtgtggta
aaaaaatacgaatgttctgtaacgaaaatgaagtaccagcaaattaaagcagagttcgaa
cggcagcagcgtagttggaaccttatggttcgtcgatacgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system