KEGG   Verticillium alfalfae: VDBG_00056Help
Entry
VDBG_00056        CDS       T02227                                 

Definition
lysophospholipase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VDBG_00056
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     VDBG_00056
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     VDBG_00056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MATTQSILPESRVLVIMTGGTICMQPTPDGLQPIGGFLKAALAPRPSFNDMSNPPQLEAY
KDGQKVMLDSLRTPPSAYSRHIRYGVLEFSPLLDSSSISSAGWTEVAQTIRENYRQYDGF
VVLHGTDSLSYTASALSFMMSDLGKPVILTGSQAPIFALQSDAVDNLLGSLIIAGTFLIP
EVGLFFHHKLFRGNRTTKNSAVNFDAFASPNCEPLAKMNGLGIDVNWPLVLRPTKIAELQ
VTQHLDTAHVACIHIFPGIKPEMLDSVLRGPDIRGLVLRTFGMGNAPGGVDGSLTKVIKA
AVDRGIVVVNVSQCLDGFVSPVYGPGTDLGRAGVIFGQDLTTEAALTKLSFLLALPNLTT
AEVSARMSASIRGEMTAETRPVFSHPGSLDSVIARLSSAETAFTALGYAIRDGDLKTVKE
ILEQGHVGEHHPLLTKADYAGNTAVHLAAVGRAEILRELLVKGASVHVRNWANNTPLFLA
QRVDNEECVQLLKEAGAHLWQNEASILGTAPTPQEGPQPQS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacacagtccatcctgccagagtctcgggtcctggtcatcatgaccggcggc
accatctgcatgcagccgacacccgacggcctgcagcctatcggagggttcctcaaagct
gctttggcacctcgtccgtcgttcaacgatatgtccaacccgccccagctggaggcgtac
aaagacggccagaaggtcatgctggacagcctgcggacgccgccgagcgcctactctcgc
cacatccgctacggcgtcttggaattttcgcccttgttggattccagctccatctcatcc
gccggctggaccgaagtggcccagaccatcagggagaactaccgccagtacgacggattc
gtcgttctgcacggcaccgattcgctgtcttatacggcgtccgccctgtccttcatgatg
tcagacctcggcaagcccgttattctgaccggatcgcaagcgccaatcttcgctctgcaa
tcggacgccgtggacaacctcctaggctctctcatcattgcgggaacgttcctcatcccc
gaggtcggcctcttcttccaccacaagctcttccgaggaaacaggacgacaaagaactcg
gccgtcaactttgatgcctttgccagtcccaactgcgagcccctggccaagatgaacggt
cttggcatcgacgtcaactggcccctcgttcttcgaccgacaaagattgccgaactccag
gttacccagcacctcgacacggcccacgttgcttgcattcacatcttccccggtatcaag
cccgagatgctcgactcggtcctgcgcggaccggacattcgaggccttgtcctacggacg
ttcggcatgggcaacgcccctggtggtgtggatggcagcctcaccaaagtcatcaaggcg
gcggtcgaccgcggtatcgtcgtggtcaacgtcagccagtgcctcgacggcttcgtctcc
cccgtctacggcccgggcaccgacctgggtcgcgcaggtgtcatctttggccaggacctc
acgactgaggctgctctgaccaagctctccttcctgctggctctcccaaacctgacgacc
gccgaggtcagcgccaggatgtcggcctccatccgcggcgagatgacggccgagacgcgg
cccgtcttctcccacccaggctcgttggattccgtcattgcccgtctgtcatctgccgag
accgccttcaccgcgctcggctatgccattcgcgacggggatctcaagacggtcaaggaa
atccttgagcagggccacgtcggcgagcaccaccccctcctgaccaaggccgactatgcg
ggcaacacggccgtgcatttggccgccgttgggcgggcagaaatcctgcgggagctgctg
gtcaagggtgcgagcgtgcacgtcaggaactgggccaacaacacgccgctcttcctggcc
cagcgtgtggataatgaggagtgcgttcagctgctgaaggaagctggtgcacacctctgg
cagaacgaagcctcgatactgggcaccgcgcccacgccccaggaagggcctcagcctcag
agctga

DBGET integrated database retrieval system