KEGG   Verticillium alfalfae: VDBG_00062Help
Entry
VDBG_00062        CDS       T02227                                 

Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
val  Verticillium alfalfae
Brite
Protein phosphatases and associated proteins [BR:val01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     VDBG_00062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MGNTTSAVLDNIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIERDEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGFISNGELFIVLK
MMVGSNLKDQQLQQIVDKTIMEADLDNDGKISFDEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaccactagtgccgtgttggacaacattgtccaggggtccaacttcgatagg
gacgaagtcgaccgtctgcgaaaacggttcatgaagctcgataaggacaactccggcacc
atcgagcgcgacgagttcctcagcctcccccagatctcctccaacccgctggcgacaaga
atgatcgccatctttgacgaagacggcggcggcgacgtcgactttcaagagttcgtctcg
ggcctcagcgccttctcgtccaagggcaacaaggagcagaagctgcggttcgccttcaag
gtgtacgacattgaccgcgacggcttcatcagcaacggcgagctcttcatcgtgctcaag
atgatggtcggcagcaacctcaaggaccagcagctccagcagattgtcgacaagaccatc
atggaggcggatctcgacaatgacggcaagatcagctttgacgagttcaccaagatggtg
gagaacacggacgtcagcatgagcatgacgctcgaccagttctag

DBGET integrated database retrieval system