KEGG   Verticillium albo-atrum: VDBG_00076Help
Entry
VDBG_00076        CDS       T02227                                 

Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
val  Verticillium albo-atrum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:val00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 618 aa AA seqDB search
MSLHEKTARYSSIVLRLLSYSFFRWVAGPAAVPLTILTLFAVYVPSFILSYLKGPDYQVV
DDQVEVIVEEPVVVEGEAGQDDKVILEAEIDETITLEEKPANPLKSFLTGAPIHHSPILS
LITFLINVALATMVSDVLFRARYQYPSNDLSFVRLGYVSHDEAKFLVREPDQTKLPVTLE
IHVKDAVAPFDNPLWLTGGEVTLLDNSTDFTSVLNVPLRHPRQRIYEWRTSNNHSGEFTS
PPKPGQLSSYNDGKFTFLSTSCILPRFPYNPLDHPLSIPGLRHLAKLLPSLQAQLMLFLG
DFIYIDVPKRLGMTAEDYRQKYRHVYASPDWAPVAQNLSWIHVLDDHEIANDWSANTTGV
YSAAVDPWHHYHAKPNPPAALVAGSSRARRLGATYYEFTQGPASFFLLDTRTYRSDNYEA
FASENKTMLGAQQLEDFLAWLHRPEPKGVQWKIVASSVPLTKNWPVNTKDTWGGFLSERR
KVLEAMWDAGARGVGVVIVSGDRHEFAATKFPPPEGGRWPETAAPHEFSCSPLNQFSSPV
PTYRQYDDEDVAIKYIHSGNAKFGALTIESHEGGTRSSLTYRLFIDGKEVWDTVVLTPTV
PEVEKTPASFWNRIMGGA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccacgagaagacagccaggtactcatcaatagtcctgaggcttctttcctac
agcttctttcgatgggttgccggacctgctgccgtccccctgactattctcacattattt
gctgtttacgtgccttctttcatactatcttacctaaaagggccagactatcaggtcgtt
gacgatcaagtagaggttattgttgaggagcctgtcgtcgtcgagggcgaggctggtcag
gatgacaaggtcatccttgaggctgaaatcgatgagaccatcacactggaggagaagccc
gccaaccccctgaagtcgtttctcaccggcgcacctattcaccacagcccgatcctgtcg
ctcatcacgttcctcatcaacgtggctctggctacaatggttagtgatgtcctcttcaga
gcgcggtatcagtatccgagcaacgatctttccttcgtcagactcggctacgtctcccac
gacgaggccaagttcctcgtgagagagcccgaccagacgaaactacctgtcacactcgag
atccatgtcaaggatgccgtcgctcccttcgacaaccccctttggctcaccggcggcgag
gtcacattgctagacaactcaactgatttcacctccgttctgaatgtgcctctgaggcac
ccccggcagcgcatctacgaatggaggacttcgaacaaccactccggcgaattcacgtcg
cctcccaagcctggacagctatcgtcctacaatgatggaaagttcaccttcttgtcgacg
tcgtgcatccttccgcggttcccttacaacccacttgatcaccctctctccatccccggt
cttcgtcatctcgcaaagctcctcccatcgctgcaggctcagctgatgcttttcctcgga
gacttcatctacattgacgttcccaagcgcctgggcatgacggccgaggactacaggcag
aaatatcgtcacgtctacgcctcccccgactgggcgcccgtcgcccagaacctcagctgg
atccacgtgctggacgaccacgaaatcgccaacgactggtcggcgaacacgaccggtgtg
tactcggccgccgtggacccctggcaccactaccacgccaagcccaacccgcccgctgct
ctcgtcgcaggcagctcccgcgcgcggagactcggcgcaacctactatgagttcacccag
ggacccgccagcttcttcctcctcgacacgcgaacgtaccgctccgacaactacgaggcc
tttgcgagcgagaacaagacgatgctcggcgcccagcagctggaggacttcctcgcctgg
ctccaccgcccggagcccaagggcgtccagtggaagatcgtagcctcctcggtccctctg
acgaagaactggcccgtcaacacaaaggacacgtggggcggcttcctctccgagaggcga
aaggtcctcgaggccatgtgggatgccggggcgcggggcgtcggcgtcgtcatcgtgtcc
ggcgaccgccacgagtttgccgccacaaagttcccgcccccggagggcggtcgctggccc
gagacggctgcgccgcacgaattctcgtgcagcccgctgaaccagttctcctcccccgtg
ccgacgtacaggcagtatgacgatgaagatgttgccatcaagtatatccactctggcaac
gccaaatttggcgcgctcactattgagagtcacgagggcggaacacgcagcagccttacc
tatcgcttgtttatcgacggcaaggaggtctgggatactgttgtcctgacgccgactgtg
cctgaggttgagaagacgcccgcgtctttctggaacaggatcatgggaggagcctag

DBGET integrated database retrieval system