KEGG   Verticillium alfalfae: VDBG_00214Help
Entry
VDBG_00214        CDS       T02227                                 

Definition
peroxiredoxin HYR1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
val  Verticillium alfalfae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VDBG_00214
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VDBG_00214
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VDBG_00214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 180 aa AA seqDB search
MASATSFYDFKPLDKRGQETPTADYKGKVVLIVNTASKCGFTPQFEGLEKLYKSIKEKHG
DDFVILGFPCNQFAGQDPGTDDDIQSFCQLNYGVTFPIMAKSDVNGDAANPLFTWLKDEK
PGIMGLKRIKWNFEKFLVGRDGKVKGRWASTTKPEALEKPVLDELAKPAPADAAPAAKPE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctacaagcttctacgacttcaagccgcttgacaagcgcggccaggagacc
cccactgccgattacaagggcaaggtcgtcctcatcgtcaacacggcctccaagtgcggt
ttcacaccgcaattcgagggcctcgagaagctctacaagtccatcaaggagaagcacggt
gatgactttgtcatcctcggcttcccctgcaaccagttcgccggccaggaccccggtacc
gacgacgacatccagagcttctgccagctcaactacggtgtcaccttccccattatggcc
aagtccgacgtcaacggcgatgcggccaaccccctcttcacctggctcaaggatgagaag
cccggtatcatgggcctcaagcgcatcaagtggaactttgagaagttccttgtcggccgc
gacggcaaggtcaagggacgctgggccagcaccaccaagcccgaagctcttgagaagccc
gtgctcgatgagctcgccaagcccgcgcccgccgatgctgctcctgctgccaagcccgag
taa

DBGET integrated database retrieval system