KEGG   Verticillium alfalfae: VDBG_00214Help
Entry
VDBG_00214        CDS       T02227                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
val  Verticillium alfalfae
Pathway
val00480  Glutathione metabolism
val00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VDBG_00214
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VDBG_00214
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VDBG_00214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 9528641
NCBI-ProteinID: XP_003008533
UniProt: C9S959
AA seq 180 aa AA seqDB search
MASATSFYDFKPLDKRGQETPTADYKGKVVLIVNTASKCGFTPQFEGLEKLYKSIKEKHG
DDFVILGFPCNQFAGQDPGTDDDIQSFCQLNYGVTFPIMAKSDVNGDAANPLFTWLKDEK
PGIMGLKRIKWNFEKFLVGRDGKVKGRWASTTKPEALEKPVLDELAKPAPADAAPAAKPE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctacaagcttctacgacttcaagccgcttgacaagcgcggccaggagacc
cccactgccgattacaagggcaaggtcgtcctcatcgtcaacacggcctccaagtgcggt
ttcacaccgcaattcgagggcctcgagaagctctacaagtccatcaaggagaagcacggt
gatgactttgtcatcctcggcttcccctgcaaccagttcgccggccaggaccccggtacc
gacgacgacatccagagcttctgccagctcaactacggtgtcaccttccccattatggcc
aagtccgacgtcaacggcgatgcggccaaccccctcttcacctggctcaaggatgagaag
cccggtatcatgggcctcaagcgcatcaagtggaactttgagaagttccttgtcggccgc
gacggcaaggtcaagggacgctgggccagcaccaccaagcccgaagctcttgagaagccc
gtgctcgatgagctcgccaagcccgcgcccgccgatgctgctcctgctgccaagcccgag
taa

DBGET integrated database retrieval system