KEGG   Verticillium alfalfae: VDBG_00252Help
Entry
VDBG_00252        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VDBG_00252
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_00252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1148 aa AA seqDB search
MSYNNDITSPSEMVMDTDDYVGIPNESEKEPVAIINPDNDNDIDNLQDLPLATDHEAMKE
LILPPLAEEPRILEDVVNTWSIPSWRGLPKREHGPIFHAGGYPWRILLFPFGNNVDQCSI
YLEHGFEPNEVPENWSCCVQFALVLSNPNDPSLYTHHVAHHRFTKEEADWGFTRFYELRK
MFNVPYENGSRPLCENDTANITAYLRVVEDETGVLWHTFLNYDSKKETGYVGLKNQGATC
YLNSLLQSLYFTNAFRTRLFYQLQTSGTAVGTNELTKSFGWETRHIFEQQDVQELSRKLM
ERMEEKMKGTPAEKVLPDMFSGKIKTYISCVNVDYESSRIEDFWDIQLNVSGNKNLIESF
QDYIQVEKMDGENQYYAGDEFKLQDANKGVIFTSFPDVLHLQLKRFEYDIQRDMMMKIND
RYEFPEEFDAAPFLIEGADKSEPWTYQLHGVLVHSGDLNAGHYYAFLKPEKDGWFYKYDD
DKVTKATMREVLEENFGGEYRLPNGSLLRAPLQKKAPIMRQNSAYMLVYIRQTRLDKILR
PVTSDDIPTHLKSRIEEETALREARKKERMEEHLYIGVKVITNETFKQHGGTDLTNFDPE
VEDASTPKFYRVLRTMTMEELTTTIAEDMQQDPRNIRCWVMVNRQNKTIRPDQPIMDLNP
TVEEVFQRAQAHRDQALRLWAEVAEETASDGKAIWPTHEPQQNGIVVKNDLILLFLKYFD
IESQTLRGVGHVYISKEKKVEELVPLILKKMGWGEKLPSDEKISLYEFEAEAVAEAAELQ
DGDVLCSSGAAERKSERNILEKRLHLNEKQVSEEATRKSDRVEDAREYYDFLHHKKTVKF
HAHPTKCDAAQFPPFELVLNSKISYDVLTERVAAQLEWEPTHLRLWTVNVSTGNPKSAVK
RGNNQTLQSILNPTGFGNLNASQRTDAFYFEVLDISLAELDTKKNIKITWLTEGITKEAS
CIQQDHLDLLVAKNGIIEDLIQALIKRADLTDEAESGRIRVYEASQHKFYRELKRDYPVI
SLNDYTNLYAERVPDDEVNVDDTNTISVFHFQGEPNRAHGVPFKFLLIEGEKFADTKKRL
EKRTGLKGKSFEKIKIALIRRTHFSKPHYLEDDDELWSIASGDDDYLGLDHVDRTRALRN
GVGDLFLR
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaacaacgacattacatcccccagcgagatggtgatggacacagacgactat
gtcggtattccgaacgaatccgagaaagagcctgtcgccatcatcaacccagacaacgac
aatgacatcgacaacttgcaagacctgcctctggcaaccgaccatgaggccatgaaggag
ctgatcctgccaccattagccgaagaaccccgcatcttagaagatgtcgtgaacacatgg
tcgatcccctcctggagggggctgccaaagcgcgagcatggtcccatcttccatgccggc
ggctacccttggcggattctgctcttcccctttggcaataatgtcgaccagtgctccatc
tacctcgaacatggcttcgaaccgaatgaagttccagagaactggagctgctgcgtgcag
tttgctctagtcctgtcgaacccaaacgatcccagtctctacacgcaccacgttgctcat
catcgcttcactaaagaagaggctgactggggattcacgaggttctacgagctgcgcaaa
atgttcaatgtgccgtacgagaacggaagccgaccactatgcgagaacgacaccgccaac
atcaccgcatatcttcgtgtcgttgaggacgagacgggcgtgctatggcatacctttctc
aactacgattcaaagaaggaaacgggctatgttggcttgaagaatcagggagccacctgt
tatctcaactcgcttctccagtccctctacttcacaaacgctttccgcacccgtctgttc
tatcagctccagacgtcaggaacggcagtaggcacgaatgagcttaccaagtcttttggg
tgggaaacgagacacatctttgaacagcaggatgttcaagaactgtcgcgcaagctcatg
gaacgcatggaagagaagatgaagggcacgccagctgaaaaggtgctgcctgacatgttc
agtggcaaaatcaagacgtacatctcttgtgtcaacgtcgactacgaatccagccgtatc
gaagatttctgggatattcagctcaacgtgagcggcaacaagaacctcatcgagagtttc
caggactacatccaagtcgagaagatggatggcgagaaccagtactatgcgggcgacgag
ttcaagctccaggacgccaacaagggcgtcattttcaccagctttcctgatgtgctgcac
ttgcagctgaaaagattcgagtacgacattcaacgagacatgatgatgaagatcaacgat
cgatacgagttcccagaggagtttgacgccgcccctttcctgattgagggcgccgacaaa
tccgagccttggacttaccaactgcacggcgtgctagtgcacagcggtgacctcaacgct
ggacattattacgccttcctgaagcccgagaaggatgggtggttttacaagtatgatgac
gacaaggttacgaaagcgacgatgcgcgaggtccttgaggaaaactttggtggcgagtat
cgactccccaatggctctttgctgcgagcaccgcttcaaaagaaggcgccgatcatgcgt
caaaatagtgcgtacatgctggtgtacattcgccaaacacgcctcgataagattctgcgc
cccgtcacctcggacgacattcctactcatctgaaatcgagaattgaagaagagactgcc
ttgcgggaagccaggaagaaggagcgtatggaggagcatctctatatcggtgttaaggtc
atcacaaacgaaactttcaagcagcacggcggcacagatctaaccaactttgaccctgaa
gtggaggatgcttcgacgcccaagttctaccgggttcttcgtacgatgactatggaggag
ctcacgaccaccatcgctgaagacatgcagcaggaccctcgcaacatccgctgctgggtc
atggtcaaccgccaaaacaagacaatccgtccggatcaaccgatcatggacctcaaccct
acggtggaggaggtattccagcgagcacaggcgcaccgggaccaggctctccgactctgg
gctgaagtcgcggaagaaacggcttccgacggcaaggctatttggcccacccatgaaccc
caacaaaatggcattgtcgtcaagaatgacttgatcttgctattcctcaagtacttcgat
atcgagtcgcagacccttcgtggcgttggtcatgtgtacatcagcaaggagaagaaggtg
gaggagctcgtgcctttgatcttgaagaaaatgggatggggtgaaaagttgccgtctgac
gagaaaatctctctatacgagtttgaagccgaagcagtcgctgaagcggctgagttgcaa
gacggcgatgttctgtgttccagcggagcagcggagcgcaagagcgaaagaaacattctc
gagaagcgtctgcacctcaatgagaagcaggtgtctgaagaagccacgcgaaagtctgat
cgcgtcgaggatgctcgggaatactacgacttcttgcaccacaagaaaactgtcaagttc
cacgcgcatcccacgaaatgtgacgcggcacagttcccgcctttcgagctggttcttaac
tcgaagatcagctacgatgtgttgacggaacgagttgcggcgcagttggagtgggagcca
acacatctccgactatggacagtcaacgtgtctacaggcaaccccaagagcgccgtgaag
cgtggcaacaaccagacgcttcagtccatcttgaatcccaccggattcggcaacctgaat
gccagccaaaggacggatgcattctatttcgaagtcctggacatcagtcttgcggagcta
gacaccaagaagaacattaagatcacgtggctcacagagggcattacgaaagaggcaagt
tgcatccagcaggaccacctggatctcttggtcgccaagaatggcatcattgaggacctc
atccaggcgctcattaagagggcagatctgactgacgaagccgagagcggtcgaattcgg
gtgtacgaggcgagccagcacaagttctaccgggagctcaagcgggactaccccgtcatc
agcctcaacgactacaccaacctgtacgcggagcgtgtgccggacgatgaagtcaacgtg
gacgacacaaacaccatctccgtgtttcacttccagggcgaacctaacagggcccatggt
gtgcctttcaaattcttgctgatcgagggcgagaagtttgcagatacgaagaagaggctg
gagaagcgcacgggcttgaagggcaagagctttgagaagatcaagattgccctgatcagg
aggacgcacttctctaaaccccattatctggaggacgacgacgagctatggtccattgca
agtggcgatgatgactatctaggcctcgatcacgtcgatcggacaagggctctacgaaac
ggcgttggagacctcttccttcggtag

DBGET integrated database retrieval system