KEGG   Verticillium alfalfae: VDBG_00285Help
Entry
VDBG_00285        CDS       T02227                                 

Definition
dual specificity protein kinase pom1
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
val  Verticillium alfalfae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    VDBG_00285
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     VDBG_00285
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   VDBG_00285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1340 aa AA seqDB search
MVKEYRPPAGPRPASFSPTKHIRDLSNPNGPQPSFQEPRVDAPMLSTSTTNGHPLFAFGG
GNGPSVQDGGDTTGAYDFLPSVSFDDLQSSLESASTDFKLTQFPSPTGQGSILESGTMTE
KPPTALPSASTPRAAGNAPPVSRPGRSGSILRRPSTSTRQTSISSTMSASSGGVGGGGGV
LDAPTAPAAMRNRRQSHYPPVSNSNIAKPPRKSIGPGILDGDYASRPGQKRRPSLISNAG
SSADSTRTSIDGTMNSGFDTTRSFTNVRTAKARSIGPPLPRTNSASLTAGNIMTPEQNRL
SAAFSPRSPHGAGRGTMAPGSAQSAASQKRASIMPGMPHSSHATGLGARTISPTDTRRMK
RLSTHQPQSLNHIADAPPPPPLEPREHSRSPSMIPRKASATPSSSRTTPDINRKSYSSGL
SIAPKSLASHSHGNNAGEDAEDVPPVPAIPKARTEDGCHARRGDKKANPPVTKRNPPGMR
LPPITVGPLNPSTAAKVAALQAGHSDRNLSPPPSRILAKTPSTPMTASKSSFFSRNHNDE
KIDLPNLRSSSTVNHNRLDSASGVDGGSSSDSLMGMTKKTRRKPSMSPFLSSSVPKNDPD
AAFIKRPKTGDIGNLTEPIPEASPQRKPSGPRPQKPVKAKPKSPVPNSDPEEPPTPSSMS
SLRRKLSLSWKRSASKNGTAQPAATTAKPTEPSVRQDSMPPPRIPISATVGNLGSIANPS
SPHVGTPKSTGTYLESRRRKSSASSLQTFGHDRTKSDNWAPNGTSTPRKEMPGDTPKERT
QPMPRNASVMQKILRPKASAATMRANDPWTADLDKDDLIAEEEIRKMGSRRKETEIAART
LDALKKRATPKERVGPHEAIRIAMLNLYERGEIIDYSDVYFCGTQNAQKVVGDLQSDKPN
FGYDDERGDYTIVPGDHLAFRYEIIDILGKGSFGQVVRCIDHKTGVLVAVKIIRNKKRFH
QQALVEVNILQKLREWDPKNKHSMVKFTHSFYFRGHLCISTELLDMNLYEFIKVNAFRGF
SLKMIRRFTKQMLSSLVMLKQHKVIHCDLKPENILLRHPLHTELKVIDFGSSCFENEKVY
TYIQSRFYRSPEVILGMTYGMPIDMWSVGCILAELYTGVPIFPGENEQEQLACIMEVFGP
PEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSSKTLQQAIKCDDEPFLDFLTRCLR
WDPDRRLKPEDAIYHEFITGRKATAPAPRIPARDASPAKRHNTASAPRPLPEPPGLGIKG
GPTLRAREATGVSPHKPVSGPVRRTSGATGAVHVAAIKRTSTGTGSISTGASNLPRAAGR
SVSAKQDLASAGAAAAMTRR
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggagtatagaccaccggctggacctagaccagccagcttctcgccgaccaaa
catatcagggacctttccaatccgaacggaccacaaccctccttccaagagccacgcgtc
gacgccccaatgctgagcacctcgacgaccaacggccacccattgtttgcgttcggtggg
gggaatgggccttctgttcaggacggcggagatacgacgggcgcctacgactttttgccc
tctgtgagcttcgacgatctccagagcagcctcgagtccgcgtccaccgacttcaagctg
acccagttcccatcacccaccggccagggcagcatcctcgagtcgggcaccatgactgaa
aaaccacccaccgctcttcccagtgccagcacgccccgtgccgctgggaacgcgcccccg
gtctcgcgcccggggcggtccggctccatactcaggcggcccagcacgtcgacccggcag
acgagcatttcatccaccatgtcggcctcgtctggtggtgttggtggtggcggtggcgtg
ctcgacgcaccgacggcccccgccgccatgaggaaccgccgacagagccactatcccccc
gtctctaacagcaacattgcgaaacctcccaggaaatcgatcgggcccggcattctggac
ggagactatgcctctcggccgggccagaagcggcggccgagtctgatatcgaacgccggc
agcagtgccgactcgacgcgcacctcgattgacggaacaatgaacagcggcttcgacacg
actcgttcgtttacgaacgttcgcaccgccaaggccaggtctattggaccgccgctgcct
cgaacaaactcggcaagcctgaccgcaggaaacattatgacaccggaacagaaccgtctg
tcggccgccttctcgccacggtcgccccacggcgcaggcaggggaaccatggcccccggc
tccgcgcagtctgcggcgagccagaagcgtgcctccatcatgcccggcatgcctcactcc
tcccatgctaccggcctcggcgcccggaccattagtcctaccgatacccggcgaatgaag
cgtctctcgacgcatcagcctcagagccttaaccacatcgccgatgcaccccctccgccg
cctctggagccgcgcgagcactcgaggtcgccctccatgatcccccgaaaggcttcggcc
actccgtcatcgtcgcgaacgacgcccgatatcaatagaaagtcgtacagctccggcctg
tcgattgcacccaagtcattggcgtctcactctcacggcaacaacgccggcgaggatgcc
gaagacgtgcccccggttcccgccatcccgaaagctaggacggaagacggctgccatgcc
cgtcgaggggacaaaaaggcgaacccccccgtcaccaagaggaatccgccgggcatgcgc
cttccgcccatcacggtcgggcctctcaacccttccactgccgccaaagtagcggctctg
caggcagggcattctgacaggaatctgagtcctcccccctcgcgcatcctcgccaagacg
ccatcgacgcccatgacggcctcgaagagcagcttcttctctcgcaaccacaatgacgag
aagattgatctcccgaaccttcgcagcagtagcacggtgaatcacaatcgactcgacagt
gcgtccggtgtggacggaggaagctcgtccgactctctgatgggcatgaccaagaagacg
cgtcgcaagcctagcatgtcgccgttcttgtcatcctctgtgcccaagaacgatcccgac
gctgcgttcatcaagaggccaaagacgggtgatatcggcaacctcactgaacccattcct
gaggcgagcccccagcgcaaaccttcgggcccacgcccgcaaaagccagtcaaggccaaa
cccaagtcacccgtaccgaattccgaccccgaagaacctcccacaccttcctccatgagc
tcgctccgccggaaactcagtctatcatggaagcgaagtgcctccaagaacggcaccgcc
caacctgcagctacgacggccaagccgacagagccaagcgtgcgacaagacagcatgccc
ccgccgcggatccccatctctgccactgtcggcaacctcggcagcatcgccaacccgtcg
agcccccacgtcggaacccccaagtccactggcacctacctcgaaagccggcgtcggaag
agctcagcgtctagcttgcaaactttcgggcacgatcggaccaagagcgacaactgggcc
ccgaatggcacgagcacccctaggaaggaaatgcccggcgacacgccaaaagaacgtacc
caaccaatgcctcgcaatgcgtcggtcatgcagaagatcctcaggcccaaggcttctgcc
gctaccatgcgggccaacgatccatggaccgcagatctcgacaaggacgacttgatcgca
gaggaggaaatccgaaagatgggctcgaggaggaaggaaactgagattgccgccaggacg
cttgacgcgctcaagaagcgcgccacgcccaaggagagggtcgggcctcatgaggccatc
aggatagccatgctgaatctctatgagcggggcgagattattgactacagcgatgtgtac
ttttgcgggacgcagaacgcgcagaaagtggtgggcgacctgcagtccgacaagcccaac
tttggctatgacgacgaacggggcgattacaccattgtccctggcgaccacctcgcattc
cggtacgagatcattgacatccttggcaagggaagtttcggacaggtcgtcaggtgtatt
gaccacaagacgggtgttctggtggccgtcaagatcattcgcaacaagaagaggttccat
caacaagctctcgtcgaagttaatatcctgcaaaagcttcgcgaatgggaccccaaaaac
aagcacagcatggtcaaatttacccacagcttctacttccgaggacacctctgcatctcc
accgagctcttggacatgaacctctatgagttcatcaaggtcaatgccttccgcggcttc
tctctcaagatgatccggcgcttcaccaagcagatgctgagctctcttgtcatgctgaag
cagcacaaggtcatccactgcgacttgaagcccgagaatatcctgctgcgtcaccctctc
cacacggaactcaaggtcatcgatttcggctccagctgtttcgaaaacgaaaaggtctac
acctacatccagtcgcgcttctatcgatcccccgaggtcattctcggcatgacatacggc
atgcccatcgacatgtggagcgtcggctgcattctggcggagctctacactggtgttccc
atcttccccggtgagaacgagcaagaacagctggcatgcatcatggaagtgtttggccca
ccagagaagcacctgatcgagaagagcaccaggaagaagttgttctttgactccatgggc
aagcctcgcctcacggtgtcctccaagggccgaagacgccgtccctcgtcaaagacgctg
caacaagccatcaagtgtgacgacgaaccgttccttgactttttgacaaggtgtctgcgg
tgggatcctgaccgtcgcctgaaacctgaagacgccatctatcacgagtttatcactggc
agaaaggctaccgcacccgccccacggatacccgcgcgcgatgcctctccggccaagcgc
cacaacacggcatcggcccctaggccgcttcccgagcctcctggactcggcattaaaggc
ggaccgacgctgcgggctcgtgaggccactggtgtcagcccgcacaagcccgtgtcaggc
cctgttcgccgaacctcaggggctacaggcgctgtgcatgtggcagctatcaaacggacg
agcaccggcacgggcagcatatcgactggcgcgagcaacctgccgagggcggcggggagg
agtgtcagcgccaagcaggatctcgcctccgctggagctgctgcagctatgacgcgaaga
tag

DBGET integrated database retrieval system