KEGG   Verticillium albo-atrum: VDBG_00285Help
Entry
VDBG_00285        CDS       T02227                                 

Definition
dual specificity protein kinase pom1
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1340 aa AA seqDB search
MVKEYRPPAGPRPASFSPTKHIRDLSNPNGPQPSFQEPRVDAPMLSTSTTNGHPLFAFGG
GNGPSVQDGGDTTGAYDFLPSVSFDDLQSSLESASTDFKLTQFPSPTGQGSILESGTMTE
KPPTALPSASTPRAAGNAPPVSRPGRSGSILRRPSTSTRQTSISSTMSASSGGVGGGGGV
LDAPTAPAAMRNRRQSHYPPVSNSNIAKPPRKSIGPGILDGDYASRPGQKRRPSLISNAG
SSADSTRTSIDGTMNSGFDTTRSFTNVRTAKARSIGPPLPRTNSASLTAGNIMTPEQNRL
SAAFSPRSPHGAGRGTMAPGSAQSAASQKRASIMPGMPHSSHATGLGARTISPTDTRRMK
RLSTHQPQSLNHIADAPPPPPLEPREHSRSPSMIPRKASATPSSSRTTPDINRKSYSSGL
SIAPKSLASHSHGNNAGEDAEDVPPVPAIPKARTEDGCHARRGDKKANPPVTKRNPPGMR
LPPITVGPLNPSTAAKVAALQAGHSDRNLSPPPSRILAKTPSTPMTASKSSFFSRNHNDE
KIDLPNLRSSSTVNHNRLDSASGVDGGSSSDSLMGMTKKTRRKPSMSPFLSSSVPKNDPD
AAFIKRPKTGDIGNLTEPIPEASPQRKPSGPRPQKPVKAKPKSPVPNSDPEEPPTPSSMS
SLRRKLSLSWKRSASKNGTAQPAATTAKPTEPSVRQDSMPPPRIPISATVGNLGSIANPS
SPHVGTPKSTGTYLESRRRKSSASSLQTFGHDRTKSDNWAPNGTSTPRKEMPGDTPKERT
QPMPRNASVMQKILRPKASAATMRANDPWTADLDKDDLIAEEEIRKMGSRRKETEIAART
LDALKKRATPKERVGPHEAIRIAMLNLYERGEIIDYSDVYFCGTQNAQKVVGDLQSDKPN
FGYDDERGDYTIVPGDHLAFRYEIIDILGKGSFGQVVRCIDHKTGVLVAVKIIRNKKRFH
QQALVEVNILQKLREWDPKNKHSMVKFTHSFYFRGHLCISTELLDMNLYEFIKVNAFRGF
SLKMIRRFTKQMLSSLVMLKQHKVIHCDLKPENILLRHPLHTELKVIDFGSSCFENEKVY
TYIQSRFYRSPEVILGMTYGMPIDMWSVGCILAELYTGVPIFPGENEQEQLACIMEVFGP
PEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSSKTLQQAIKCDDEPFLDFLTRCLR
WDPDRRLKPEDAIYHEFITGRKATAPAPRIPARDASPAKRHNTASAPRPLPEPPGLGIKG
GPTLRAREATGVSPHKPVSGPVRRTSGATGAVHVAAIKRTSTGTGSISTGASNLPRAAGR
SVSAKQDLASAGAAAAMTRR
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggagtatagaccaccggctggacctagaccagccagcttctcgccgaccaaa
catatcagggacctttccaatccgaacggaccacaaccctccttccaagagccacgcgtc
gacgccccaatgctgagcacctcgacgaccaacggccacccattgtttgcgttcggtggg
gggaatgggccttctgttcaggacggcggagatacgacgggcgcctacgactttttgccc
tctgtgagcttcgacgatctccagagcagcctcgagtccgcgtccaccgacttcaagctg
acccagttcccatcacccaccggccagggcagcatcctcgagtcgggcaccatgactgaa
aaaccacccaccgctcttcccagtgccagcacgccccgtgccgctgggaacgcgcccccg
gtctcgcgcccggggcggtccggctccatactcaggcggcccagcacgtcgacccggcag
acgagcatttcatccaccatgtcggcctcgtctggtggtgttggtggtggcggtggcgtg
ctcgacgcaccgacggcccccgccgccatgaggaaccgccgacagagccactatcccccc
gtctctaacagcaacattgcgaaacctcccaggaaatcgatcgggcccggcattctggac
ggagactatgcctctcggccgggccagaagcggcggccgagtctgatatcgaacgccggc
agcagtgccgactcgacgcgcacctcgattgacggaacaatgaacagcggcttcgacacg
actcgttcgtttacgaacgttcgcaccgccaaggccaggtctattggaccgccgctgcct
cgaacaaactcggcaagcctgaccgcaggaaacattatgacaccggaacagaaccgtctg
tcggccgccttctcgccacggtcgccccacggcgcaggcaggggaaccatggcccccggc
tccgcgcagtctgcggcgagccagaagcgtgcctccatcatgcccggcatgcctcactcc
tcccatgctaccggcctcggcgcccggaccattagtcctaccgatacccggcgaatgaag
cgtctctcgacgcatcagcctcagagccttaaccacatcgccgatgcaccccctccgccg
cctctggagccgcgcgagcactcgaggtcgccctccatgatcccccgaaaggcttcggcc
actccgtcatcgtcgcgaacgacgcccgatatcaatagaaagtcgtacagctccggcctg
tcgattgcacccaagtcattggcgtctcactctcacggcaacaacgccggcgaggatgcc
gaagacgtgcccccggttcccgccatcccgaaagctaggacggaagacggctgccatgcc
cgtcgaggggacaaaaaggcgaacccccccgtcaccaagaggaatccgccgggcatgcgc
cttccgcccatcacggtcgggcctctcaacccttccactgccgccaaagtagcggctctg
caggcagggcattctgacaggaatctgagtcctcccccctcgcgcatcctcgccaagacg
ccatcgacgcccatgacggcctcgaagagcagcttcttctctcgcaaccacaatgacgag
aagattgatctcccgaaccttcgcagcagtagcacggtgaatcacaatcgactcgacagt
gcgtccggtgtggacggaggaagctcgtccgactctctgatgggcatgaccaagaagacg
cgtcgcaagcctagcatgtcgccgttcttgtcatcctctgtgcccaagaacgatcccgac
gctgcgttcatcaagaggccaaagacgggtgatatcggcaacctcactgaacccattcct
gaggcgagcccccagcgcaaaccttcgggcccacgcccgcaaaagccagtcaaggccaaa
cccaagtcacccgtaccgaattccgaccccgaagaacctcccacaccttcctccatgagc
tcgctccgccggaaactcagtctatcatggaagcgaagtgcctccaagaacggcaccgcc
caacctgcagctacgacggccaagccgacagagccaagcgtgcgacaagacagcatgccc
ccgccgcggatccccatctctgccactgtcggcaacctcggcagcatcgccaacccgtcg
agcccccacgtcggaacccccaagtccactggcacctacctcgaaagccggcgtcggaag
agctcagcgtctagcttgcaaactttcgggcacgatcggaccaagagcgacaactgggcc
ccgaatggcacgagcacccctaggaaggaaatgcccggcgacacgccaaaagaacgtacc
caaccaatgcctcgcaatgcgtcggtcatgcagaagatcctcaggcccaaggcttctgcc
gctaccatgcgggccaacgatccatggaccgcagatctcgacaaggacgacttgatcgca
gaggaggaaatccgaaagatgggctcgaggaggaaggaaactgagattgccgccaggacg
cttgacgcgctcaagaagcgcgccacgcccaaggagagggtcgggcctcatgaggccatc
aggatagccatgctgaatctctatgagcggggcgagattattgactacagcgatgtgtac
ttttgcgggacgcagaacgcgcagaaagtggtgggcgacctgcagtccgacaagcccaac
tttggctatgacgacgaacggggcgattacaccattgtccctggcgaccacctcgcattc
cggtacgagatcattgacatccttggcaagggaagtttcggacaggtcgtcaggtgtatt
gaccacaagacgggtgttctggtggccgtcaagatcattcgcaacaagaagaggttccat
caacaagctctcgtcgaagttaatatcctgcaaaagcttcgcgaatgggaccccaaaaac
aagcacagcatggtcaaatttacccacagcttctacttccgaggacacctctgcatctcc
accgagctcttggacatgaacctctatgagttcatcaaggtcaatgccttccgcggcttc
tctctcaagatgatccggcgcttcaccaagcagatgctgagctctcttgtcatgctgaag
cagcacaaggtcatccactgcgacttgaagcccgagaatatcctgctgcgtcaccctctc
cacacggaactcaaggtcatcgatttcggctccagctgtttcgaaaacgaaaaggtctac
acctacatccagtcgcgcttctatcgatcccccgaggtcattctcggcatgacatacggc
atgcccatcgacatgtggagcgtcggctgcattctggcggagctctacactggtgttccc
atcttccccggtgagaacgagcaagaacagctggcatgcatcatggaagtgtttggccca
ccagagaagcacctgatcgagaagagcaccaggaagaagttgttctttgactccatgggc
aagcctcgcctcacggtgtcctccaagggccgaagacgccgtccctcgtcaaagacgctg
caacaagccatcaagtgtgacgacgaaccgttccttgactttttgacaaggtgtctgcgg
tgggatcctgaccgtcgcctgaaacctgaagacgccatctatcacgagtttatcactggc
agaaaggctaccgcacccgccccacggatacccgcgcgcgatgcctctccggccaagcgc
cacaacacggcatcggcccctaggccgcttcccgagcctcctggactcggcattaaaggc
ggaccgacgctgcgggctcgtgaggccactggtgtcagcccgcacaagcccgtgtcaggc
cctgttcgccgaacctcaggggctacaggcgctgtgcatgtggcagctatcaaacggacg
agcaccggcacgggcagcatatcgactggcgcgagcaacctgccgagggcggcggggagg
agtgtcagcgccaagcaggatctcgcctccgctggagctgctgcagctatgacgcgaaga
tag

DBGET integrated database retrieval system