KEGG   Verticillium alfalfae: VDBG_00315Help
Entry
VDBG_00315        CDS       T02227                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
val  Verticillium alfalfae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VDBG_00315
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VDBG_00315
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDBG_00315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MSFSSLVQDLSLRDSGMPRRPGPRGTASASTIDDGRSQVSRAMSYASTAATSVSISGDIS
SQLHGGYHHPLARSWQAERQLTKSMLIYPIFISDNDDDETLIPSLPGQSRRGLNKLVPFL
EALVHKGLRSVMLFGVPLRPGTKDALGTAADDPSGPVIRTIRLIRQRFPQLFICTDVCLC
EYTSHGHCGILRDDGTLNNALSVDRISDVAVAYARAGAHCVAPSDMNDGRIRAIKLKLIE
EGISHNTVLMSYAAKFSGCLYGPFRDAAGSVPSFGDRKCYQLPPGGRGLARRAITRDINE
GADIIMVKPASQYLDIISDAKDLGRDLPVAAYQVSGEFAMIHAGAKAGVFDLKTMAFEST
EGILRAGATIIVSYFTPDFLDWLSN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctctagcctcgttcaggatctcagcctccgcgactcaggcatgccccgccgt
cctgggcctcgcggcaccgcttcggcttcgaccatcgatgacggtcggtcgcaggtctcg
cgtgccatgtcgtacgccagcactgcggccaccagtgtcagcatctctggcgacatctct
agccagctccacggaggctaccaccacccgctcgccaggtcgtggcaagcagagaggcag
ttgaccaagtctatgctcatctaccccattttcatttccgacaacgatgacgacgaaact
ctaatcccctctctgccaggccagagtcgccgtggcctcaacaagcttgtgccgttcctc
gaggcgttagtgcacaagggcttgcgatctgtcatgctctttggcgtccctctgcgtccg
ggtactaaggacgctctcggtaccgccgccgatgacccatccggacccgtcatccggacc
attcgtcttattcgccaacgattcccccaactcttcatctgcaccgacgtctgtctttgc
gaatacacctcacacggccactgcggcattctccgcgatgatggtaccctgaacaacgcc
ctgtctgttgaccgcatttccgatgtggctgttgcctacgcacgggctggagcgcactgt
gttgcgccctcggacatgaacgacgggcgcattcgcgccatcaagctcaagctgattgaa
gagggaatctcccacaacacagtcctcatgtcgtatgcggccaagttctccggctgcttg
tacggacctttccgcgacgccgctggctcggtgccatcattcggcgaccgcaagtgctac
cagcttcctcccggcggtcgcggccttgcccgccgcgccatcacgcgtgacatcaacgag
ggcgccgacataatcatggtcaagccggccagccagtaccttgacatcatcagtgatgca
aaggatctgggccgggacctcccagtggcggcgtaccaagtcagcggcgagtttgccatg
attcacgcgggagccaaggcgggggtctttgaccttaagacgatggcctttgagtcaacc
gaaggcattcttcgggcgggcgcgaccatcatcgtcagctacttcacgcccgatttcctt
gactggctctccaactga

DBGET integrated database retrieval system