KEGG   Verticillium alfalfae: VDBG_00323Help
Entry
VDBG_00323        CDS       T02227                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
val  Verticillium alfalfae
Pathway
val00630  Glyoxylate and dicarboxylate metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01200  Carbon metabolism
Module
val_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VDBG_00323
Enzymes [BR:val01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     VDBG_00323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9528832
NCBI-ProteinID: XP_003008642
UniProt: C9S5E4
AA seq 546 aa AA seqDB search
MAANNMVNPAVDPETEDELFNQEVEQIKQWWSDSRWRHTKRTFTPEQIASKRGNLKVEYP
GNVQSKKLWNILENRFQNKDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASASDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSHPKSARAQLANVDYLRPIIADADT
GHGGLTAVMKLTKLFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGSDLVAVARTDAEAATLITTTIDPRDHAFILGSTNPSLQPLNDLMNAAQEAGKTGAE
LQTIEDEWIAKANLQRFDDAVVAAVRAGPQPDKEAAVARYLAAAKGKSNTEARAVAKGVL
GIDIFFDWDAPRTREGYFRLKGGCDCAINRAIAYAPYCDAIWMESKLPDYKQAQEFAKGV
HAVWPEQKLAYNLSPSFNWKTAMPRDEQETYIRRLASLGYCWQFITLAGLHTTALISDKF
ARAYSQQGMRAYGELVQEPEMEGGVDVVKHQKWSGASYVDELLKMVSGGISSTAAMGKGV
TEDQFH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaacatggtgaacccggccgtggacccagagaccgaggacgagctcttc
aaccaggaggtcgagcagatcaagcagtggtggagcgactcaagatggcgccacaccaag
cgcaccttcacccccgagcagatcgcctccaagcgcggcaacctcaaggttgagtacccg
ggaaacgtccagtccaaaaagctgtggaacattctcgagaaccgcttccagaacaaggac
gccagttacacgtacggctgtctcgagcctaccatggtgacacagatggccaagtacctc
gacaccgtctacgtctctggctggcagtcgtcctctaccgcctcggcctctgacgagccc
ggccctgatctggctgattatccctacacaaccgtccccaataaggtcggccatctcttc
atggctcagctgttccacgaccgcaaacagcgccaggagcgcctctcccaccccaagtcg
gcgcgcgcccagctcgccaacgtcgactacctccgtcccatcattgccgatgccgatacc
ggtcacggtggcctcacggccgtcatgaagctgaccaagctcttcgtcgagaagggcgcc
gctggcattcacattgaggaccaggctcctggcaccaaaaagtgcggccacatggccggc
aaggtcctcgtgcccatcagcgagcacatcaaccgtctcgttgccatccgcgcccaggcg
gacatcatgggttccgacctcgtcgccgtcgctcgcaccgacgccgaggccgccaccctc
atcaccaccaccattgaccctcgcgaccacgctttcatccttggcagcacgaaccccagc
ctccagcccctcaatgaccttatgaacgccgcccaggaggctggcaagactggcgccgag
ctccagaccatcgaggatgagtggatcgccaaggccaaccttcagcgcttcgatgacgcc
gtcgtcgccgccgtccgcgccggtccccaaccggacaaggaggccgccgtcgcccgctac
ctcgccgctgccaagggcaagtcgaacacggaggcccgtgccgttgccaagggcgtcctc
ggcatcgacatcttcttcgactgggacgcgccccgcacgcgcgagggctacttccgcctc
aagggcggctgcgactgtgccatcaaccgcgccattgcctacgcaccctactgcgacgcc
atctggatggagagcaagctgcccgactacaaacaggcgcaggagttcgccaagggcgtc
cacgccgtgtggcctgagcagaagctcgcctacaacctctccccgtccttcaactggaag
acggccatgccccgcgacgagcaggagacgtacatccgccgtctcgcgtccctgggttac
tgctggcagttcatcacgctcgcgggcctgcacacgacggccctcatcagcgacaagttt
gcccgcgcctacagccagcagggcatgcgcgcctacggcgagctcgtccaggagcccgag
atggagggcggcgtcgacgtcgtcaagcaccaaaagtggagcggcgccagctacgtcgac
gagctgctcaagatggtcagcggcggcatcagcagcaccgccgccatgggcaagggcgtg
acggaagaccagttccactaa

DBGET integrated database retrieval system