KEGG   Verticillium albo-atrum: VDBG_00323Help
Entry
VDBG_00323        CDS       T02227                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
val  Verticillium albo-atrum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:val01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:val00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MAANNMVNPAVDPETEDELFNQEVEQIKQWWSDSRWRHTKRTFTPEQIASKRGNLKVEYP
GNVQSKKLWNILENRFQNKDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASASDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSHPKSARAQLANVDYLRPIIADADT
GHGGLTAVMKLTKLFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGSDLVAVARTDAEAATLITTTIDPRDHAFILGSTNPSLQPLNDLMNAAQEAGKTGAE
LQTIEDEWIAKANLQRFDDAVVAAVRAGPQPDKEAAVARYLAAAKGKSNTEARAVAKGVL
GIDIFFDWDAPRTREGYFRLKGGCDCAINRAIAYAPYCDAIWMESKLPDYKQAQEFAKGV
HAVWPEQKLAYNLSPSFNWKTAMPRDEQETYIRRLASLGYCWQFITLAGLHTTALISDKF
ARAYSQQGMRAYGELVQEPEMEGGVDVVKHQKWSGASYVDELLKMVSGGISSTAAMGKGV
TEDQFH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaacatggtgaacccggccgtggacccagagaccgaggacgagctcttc
aaccaggaggtcgagcagatcaagcagtggtggagcgactcaagatggcgccacaccaag
cgcaccttcacccccgagcagatcgcctccaagcgcggcaacctcaaggttgagtacccg
ggaaacgtccagtccaaaaagctgtggaacattctcgagaaccgcttccagaacaaggac
gccagttacacgtacggctgtctcgagcctaccatggtgacacagatggccaagtacctc
gacaccgtctacgtctctggctggcagtcgtcctctaccgcctcggcctctgacgagccc
ggccctgatctggctgattatccctacacaaccgtccccaataaggtcggccatctcttc
atggctcagctgttccacgaccgcaaacagcgccaggagcgcctctcccaccccaagtcg
gcgcgcgcccagctcgccaacgtcgactacctccgtcccatcattgccgatgccgatacc
ggtcacggtggcctcacggccgtcatgaagctgaccaagctcttcgtcgagaagggcgcc
gctggcattcacattgaggaccaggctcctggcaccaaaaagtgcggccacatggccggc
aaggtcctcgtgcccatcagcgagcacatcaaccgtctcgttgccatccgcgcccaggcg
gacatcatgggttccgacctcgtcgccgtcgctcgcaccgacgccgaggccgccaccctc
atcaccaccaccattgaccctcgcgaccacgctttcatccttggcagcacgaaccccagc
ctccagcccctcaatgaccttatgaacgccgcccaggaggctggcaagactggcgccgag
ctccagaccatcgaggatgagtggatcgccaaggccaaccttcagcgcttcgatgacgcc
gtcgtcgccgccgtccgcgccggtccccaaccggacaaggaggccgccgtcgcccgctac
ctcgccgctgccaagggcaagtcgaacacggaggcccgtgccgttgccaagggcgtcctc
ggcatcgacatcttcttcgactgggacgcgccccgcacgcgcgagggctacttccgcctc
aagggcggctgcgactgtgccatcaaccgcgccattgcctacgcaccctactgcgacgcc
atctggatggagagcaagctgcccgactacaaacaggcgcaggagttcgccaagggcgtc
cacgccgtgtggcctgagcagaagctcgcctacaacctctccccgtccttcaactggaag
acggccatgccccgcgacgagcaggagacgtacatccgccgtctcgcgtccctgggttac
tgctggcagttcatcacgctcgcgggcctgcacacgacggccctcatcagcgacaagttt
gcccgcgcctacagccagcagggcatgcgcgcctacggcgagctcgtccaggagcccgag
atggagggcggcgtcgacgtcgtcaagcaccaaaagtggagcggcgccagctacgtcgac
gagctgctcaagatggtcagcggcggcatcagcagcaccgccgccatgggcaagggcgtg
acggaagaccagttccactaa

DBGET integrated database retrieval system