KEGG   Verticillium albo-atrum: VDBG_00333Help
Entry
VDBG_00333        CDS       T02227                                 

Definition
protein kinase byr1
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MPDPFAPRSMKRKNVKGLALTPASPKPPPTAETSRHDYDSRDQDGNDQSAQLEIGIEYKL
DLKQEDLEVLKELGSGNGGTVSKVRHVLTGTVMARKVIHVEAKKEMRKRIVRELQIMHGC
HSANIVNFYGAFLNDNNDVIMCMEYMDVGSLDRVSRVFGPIRVDVLGKIAEATLGGLTYL
YSKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELVNSVADTFVGTSTYMAPERIQGEKY
TVKSDVWSFGLTIMELAIGKFPFAASEQLSDGDGAPAGILDLLQQIVHEPAPKLPKSDAF
PSILEDMIQRCLSKVPEERSTPQELFVSTCPIALSTGFPCHKKRQRLTKHSGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatcctttcgctccgcgctcgatgaagcgcaagaatgtcaagggcctcgccctg
acgcctgcctctcccaaaccgcccccaaccgccgaaactagcaggcatgactacgattcc
cgtgatcaggacggcaacgaccagagcgcacaactcgagattggcattgagtacaagctg
gacctgaaacaagaagacctggaggtcctgaaagaactgggatccggcaacggtggtacg
gtcagcaaggttaggcatgttcttaccggaactgtcatggccagaaaggtcatccacgta
gaagcgaagaaggagatgcgtaaacgtatagtaagagagctacagattatgcacggatgc
cactcggcaaacattgtcaacttttacggcgcattcctcaacgacaacaacgatgtcatc
atgtgtatggaatacatggacgttggttctttggaccgggtgtcgcgggtctttggtccc
attcgagtcgatgtgctcggcaagatcgctgaagctacattaggtggcttgacgtacctc
tactcaaagcatcacatcatgcaccgcgacatcaaaccctcgaatattctggtcaactct
aggggcagtatcaagttgtgtgactttggtgtttctggcgaacttgtcaactctgtcgca
gacacttttgttggcacatcgacttatatggcccctgagcgtatccaaggcgaaaagtat
acagtcaagtcagatgtctggagtttcggccttaccatcatggagcttgccattggaaag
tttccgttcgccgcaagcgagcagctatcggatggggatggtgcccctgctggtattctt
gacctgttgcagcaaatcgtccacgagcccgcaccgaagctgccgaagagtgacgcattc
ccttctatcctcgaggatatgattcaaaggtgtctctctaaagtccccgaggagcggtcc
acgcctcaggaattgtttgtaagtacctgcccaattgctttgtctaccgggttcccgtgc
cacaagaagagacagcgtttgaccaaacactcaggatcgtga

DBGET integrated database retrieval system