KEGG   Verticillium alfalfae: VDBG_00333Help
Entry
VDBG_00333        CDS       T02227                                 

Definition
(RefSeq) protein kinase byr1
  KO
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
val  Verticillium alfalfae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    VDBG_00333
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     VDBG_00333
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   VDBG_00333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MPDPFAPRSMKRKNVKGLALTPASPKPPPTAETSRHDYDSRDQDGNDQSAQLEIGIEYKL
DLKQEDLEVLKELGSGNGGTVSKVRHVLTGTVMARKVIHVEAKKEMRKRIVRELQIMHGC
HSANIVNFYGAFLNDNNDVIMCMEYMDVGSLDRVSRVFGPIRVDVLGKIAEATLGGLTYL
YSKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELVNSVADTFVGTSTYMAPERIQGEKY
TVKSDVWSFGLTIMELAIGKFPFAASEQLSDGDGAPAGILDLLQQIVHEPAPKLPKSDAF
PSILEDMIQRCLSKVPEERSTPQELFVSTCPIALSTGFPCHKKRQRLTKHSGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatcctttcgctccgcgctcgatgaagcgcaagaatgtcaagggcctcgccctg
acgcctgcctctcccaaaccgcccccaaccgccgaaactagcaggcatgactacgattcc
cgtgatcaggacggcaacgaccagagcgcacaactcgagattggcattgagtacaagctg
gacctgaaacaagaagacctggaggtcctgaaagaactgggatccggcaacggtggtacg
gtcagcaaggttaggcatgttcttaccggaactgtcatggccagaaaggtcatccacgta
gaagcgaagaaggagatgcgtaaacgtatagtaagagagctacagattatgcacggatgc
cactcggcaaacattgtcaacttttacggcgcattcctcaacgacaacaacgatgtcatc
atgtgtatggaatacatggacgttggttctttggaccgggtgtcgcgggtctttggtccc
attcgagtcgatgtgctcggcaagatcgctgaagctacattaggtggcttgacgtacctc
tactcaaagcatcacatcatgcaccgcgacatcaaaccctcgaatattctggtcaactct
aggggcagtatcaagttgtgtgactttggtgtttctggcgaacttgtcaactctgtcgca
gacacttttgttggcacatcgacttatatggcccctgagcgtatccaaggcgaaaagtat
acagtcaagtcagatgtctggagtttcggccttaccatcatggagcttgccattggaaag
tttccgttcgccgcaagcgagcagctatcggatggggatggtgcccctgctggtattctt
gacctgttgcagcaaatcgtccacgagcccgcaccgaagctgccgaagagtgacgcattc
ccttctatcctcgaggatatgattcaaaggtgtctctctaaagtccccgaggagcggtcc
acgcctcaggaattgtttgtaagtacctgcccaattgctttgtctaccgggttcccgtgc
cacaagaagagacagcgtttgaccaaacactcaggatcgtga

DBGET integrated database retrieval system