KEGG   Verticillium albo-atrum: VDBG_00592Help
Entry
VDBG_00592        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 879 aa AA seqDB search
MPGGGAPAVNGAGDMGPVPGHGAHIVHGGHGGHGGHGNSRRRPPPPPSYVPQYHQQHHQQ
HQHIPPMYPNYMNPYAGGQQFYQQLPPQYQNGGMPTAYMQHYQQPYMRSPPAMQQFVPMA
GVSVPQPYPRQHQQSPALATPYQPPPMPSAIAPHTPTSTHSSHIMAEASALSSASPATSQ
IEQGRALAPAQEELVQPETAAPAPPVRQPTPEPAEPKEPFRAPLPWLSRPDLDFPKHTRV
KRRKRAPLVSADKGVTLPSDGNGPLSESADHVCTDAAVTDESQVSAGTASTLSAASTPAT
PHANAASTSHTNSTETTTQNTRPVTSGSGASTSQSPAPSSSRPVVPVVPAIPKGSPKTTT
TGAEASSEVTKEPAAQDAPSETPSADVPSEEKAQEPSEEARKSTPRAPPSSWSALFAKNA
AAAAAAKNRNAQNGAAGQGINGTSPDDVDRPFDSTFPSDNSVNTIAAALRAYRVRNPEKV
KYVEPRGLVNIGNMCYMNSRKGPFEFQEPNTHPGRNYGTSFTPEFIYQAIEPDKRFENMR
RGHQQDAEEFFGLLLQSLDDECAKVMGVASGNAPHPAPASANADATADGWLEVGAKQRAA
VTRSSGASSSTPITQIFGGLLRSELRVTGKQDSITTEPYQALQLDIGANDVRNVVDALKR
LTAHEKLEGSGFNSPHGKNATVVKQTLIDTLPPVLILHLKRFHFDAEGGTTKIWKKVGYP
LELEIPVQALARQWRASNKGGEGPKYKLIAVVYHHGKHANGGHYTADVRRQDEHEWIRLD
DTVIRRVRSEDVAEVGEEEPAKATTQASGSRDVSTNRFGAMNDDDAGDRGEWTSVDKTNG
NKNRWSAVANGAASQSRGKQVKESVKDNKVAYLLFYQRV
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgccggggggtggagcgccagcggtgaacggtgctggcgacatgggccctgtgcctggc
catggcgcgcacattgttcacggcggacatggtgggcatggaggacacggaaactcgagg
aggcggccgccgccgccgccctcctatgttccgcagtatcatcagcaacaccatcagcag
caccaacacatcccgcccatgtatcccaactacatgaacccctatgcaggcggccagcaa
ttctaccagcagctgccgccacagtaccagaacgggggcatgcccactgcctatatgcag
cactaccagcagccatacatgcgctcgcctccggctatgcagcagtttgtccccatggct
ggcgtcagtgtccctcagccttaccctcgacagcaccagcagtctcctgctctcgcgact
ccctaccagcctcctcccatgccctctgccattgcgccacacacgcccacttcgacgcac
tcgtcccatatcatggcagaggcgtctgccctctcttccgcgtcacccgcgacatcccag
atcgaacaggggcgagcgctcgcccctgcccaagaggagttggtccagccagaaacggcc
gcgcctgcacctcctgtgcgacagcccactcccgagcccgctgagcctaaggagcccttc
cgagcaccgcttccatggctttcccggcccgatctcgatttccccaaacacacgcgcgtc
aagcggcgcaagcgagcgcccctagtctcggccgacaagggagtcacactccccagcgat
ggcaatggtcccctgagcgagtcagccgatcacgtctgtacagatgccgccgtcacggac
gagtcacaggtatcagctggcacggcatccacactttcggcggcttcgactcctgcgact
ccccatgccaatgctgcttcgacatctcatactaactcaacggagaccacgactcagaac
acgaggcctgtcacaagcggctccggcgcttctacttcgcagagccccgccccttcgtcg
tcacgtcccgtcgtacccgttgttccggccattcccaaaggcagcccgaagactaccacg
acaggcgccgaagcgtcctccgaggttaccaaagaacccgctgcccaggacgcgccgagc
gagacaccttctgctgatgtcccgtccgaggaaaaagcccaggagccgagcgaggaggct
cgcaagtctaccccacgcgcaccgccgtcaagctggagtgccctgttcgcgaaaaacgct
gctgccgcagcagctgccaagaaccggaacgctcagaacggcgcagccggtcaagggatt
aacggcacttctcctgacgatgtggacaggccattcgactccaccttcccttccgacaac
agcgtgaacacaattgctgcggcgctgagagcataccgtgttcgcaaccccgagaaagtc
aagtatgttgagccaaggggcttggtcaatatcgggaacatgtgttacatgaattctcga
aaaggtccctttgagtttcaagagccaaacacccatcctggacgcaattacggaacttca
tttactcctgaattcatttaccaggccatcgagcccgacaagcgttttgaaaatatgagg
cgtggtcatcagcaggatgccgaggagttctttggtcttcttctgcagtctcttgatgat
gagtgcgctaaggtgatgggcgtcgcttctggcaacgcccctcatcctgcgccggcatcg
gcgaacgcagacgcgacggcagacggctggcttgaagttggcgccaagcagcgtgccgct
gtgacacgttcgtccggagccagctcgtcgacccctatcacccagatcttcggcggcttg
ttgcgatccgaattgcgcgtcactggcaagcaggactcaattacgacagaaccgtaccag
gctctacagcttgacattggggcaaacgacgtgagaaacgttgtggatgctctgaagagg
ctgacggcgcatgagaagcttgagggctctggattcaactccccccacggaaagaacgca
actgttgtcaagcagacgctgatcgacacactgcctccagtgctcatcctgcacctaaag
cgcttccatttcgatgctgagggcggcaccacaaagatctggaagaaggtcggctatccc
ctcgagctcgagattcccgtgcaggctcttgccaggcagtggcgggccagcaacaaggga
ggcgaggggcccaagtacaagctcatcgccgttgtgtaccatcatggcaagcatgccaac
ggaggtcattacactgcagatgtaagacgtcaagacgagcatgagtggattcgcttggac
gacacagtcattcgacgagtcaggagcgaggacgtggccgaggttggtgaggaggagcct
gcaaaggcgacgacgcaggcctcaggttctcgcgacgtctcgacgaacaggtttggcgcc
atgaacgatgacgatgccggtgatcgtggcgagtggacatcggtggacaagaccaacgga
aacaagaaccgctggagcgccgtcgctaacggagctgcctcgcagtctcgtggcaaacag
gtcaaggagagcgtgaaagataacaaggtggcatacctactcttctaccagcgtgtctag

DBGET integrated database retrieval system