KEGG   Verticillium alfalfae: VDBG_00657Help
Entry
VDBG_00657        CDS       T02227                                 

Definition
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
val  Verticillium alfalfae
Pathway
val00250  Alanine, aspartate and glutamate metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VDBG_00657
Enzymes [BR:val01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VDBG_00657
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C44
   VDBG_00657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC
Motif
Other DBs
NCBI-GeneID: 9530545
NCBI-ProteinID: XP_003008975
UniProt: C9S6Q8
AA seq 584 aa AA seqDB search
MCGIFACHRHPDVEKFKPTALKLAKAVRHRGPDWSGSIIANNTILCHERLCIVGVESGAQ
PLTSTDENIVLAVNGEIYNHRLIRKHLKHSYHFKTTSDCEVIIPLYMEYGLDAPKHLDGM
FSFVLYDKEQDRTVAARDPIGITTFYQGWNSKQPETVYFASELKSLHPVCDKIEAFPPGH
IYDSKTGKTTRYFEPTWWDGERVPEKPLDLKLLRETLEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRENLRLQKLALEASNRAAAKAEAAKSENPDVGEGLVGIDDEDELSTVTYLP
QLNSFSIGLPGSPDNKAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLESYDVTTIRA
STPMYLLSRKIKAMGIKMVLSGEGSDEEFGGYLYFHGAPDKKALHEETVRRVKNLHLSDC
LRANKSTSAWGLEARVPFLDKEFLEVAMNIDPQEKMITKERLEKYIVRKAFDTSDDPSAE
PYLPEKILWRQKEQFSDGVGYGWIDALKDNAEKHVTDEMMKNPKPEWGNDIPDSKEAYWY
RTMFDEHFPASCASTVVRWTPTWSKQTDPSGRAIAIHEQKYETA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatctttgcgtgccaccgtcaccccgacgttgagaaattcaagcccacagcc
ttgaagcttgccaaggctgtcaggcaccgtggccccgattggagcggaagcatcatcgcc
aacaacacgatcctgtgccatgagcgtctctgcattgtcggcgtcgagtccggcgcccag
cccctgacgagcaccgacgagaacattgtccttgctgtcaacggcgagatctacaaccac
cgcctcatccgcaagcacctcaagcactcataccacttcaagaccacctcggactgcgag
gttattatcccgctgtatatggagtatggcctcgacgcgccgaagcacctcgacggcatg
ttctcgtttgtcctctacgacaaggagcaggaccggacagttgccgcccgtgaccccatc
ggcatcaccaccttctaccagggctggaactccaagcagcccgagactgtgtacttcgcc
tctgagctgaagtccctgcaccccgtctgcgacaagatcgaggccttccctcctggacac
atttacgactccaagaccggcaagacgacgagatactttgagcctacctggtgggatggc
gagcgcgttcccgagaagcctctcgacctcaagctcctgcgcgagaccctcgagaagtct
gtcaggaaacgactcatggccgaggtcccctacggtgttctgctgtctggtggcctcgac
tccagtctcgtggcttcgattgcccagagggagaacctgcgcctgcagaagctggcgctg
gaggccagcaacagggccgccgccaaggctgaggctgccaagtctgagaaccccgacgtg
ggcgagggtctcgttggtatcgacgacgaggatgagctgtcgactgtcacctaccttcct
caactcaactccttctccatcggtctccccggctcgcccgacaacaaggccgccctcgag
gtggccaagttccttggcaccaagcaccatgttatgaccttcaccattgaggacggcctc
aacgccctctccgatgtcatctaccacctcgagtcgtacgacgtcaccactatccgcgcc
tctacccccatgtacctgctgtcgcgcaagatcaaggccatgggtatcaagatggtgctc
agtggtgagggcagcgacgaggagtttggcggttacctttacttccacggcgccccggac
aagaaggcgctccacgaggagacggttcgccgcgtcaagaacctgcacctttctgactgc
ctgcgcgccaacaagtcgacgtcggcgtggggtctggaggctcgcgtgcccttcctggac
aaggagttccttgaggttgccatgaacatcgaccctcaggagaagatgatcaccaaggag
aggctcgagaagtatattgtccgcaaggcgtttgacacctcggacgaccccagcgcggag
ccttacctgcccgagaagattctctggaggcagaaggagcagttctccgatggtgttgga
tacgggtggatcgacgcgctcaaggacaacgccgagaaacacgtgacggacgagatgatg
aagaaccccaagcccgagtggggcaacgatattcccgactccaaggaggcgtactggtac
cgcaccatgttcgacgaacacttccccgcgtcgtgcgcgtcgacagtcgtgaggtggacc
cctacctggtccaagcagaccgaccccagcggaagagctattgccatccacgagcaaaag
tacgagactgcatga

DBGET integrated database retrieval system