KEGG   Verticillium albo-atrum: VDBG_00657Help
Entry
VDBG_00657        CDS       T02227                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
val  Verticillium albo-atrum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:val00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MCGIFACHRHPDVEKFKPTALKLAKAVRHRGPDWSGSIIANNTILCHERLCIVGVESGAQ
PLTSTDENIVLAVNGEIYNHRLIRKHLKHSYHFKTTSDCEVIIPLYMEYGLDAPKHLDGM
FSFVLYDKEQDRTVAARDPIGITTFYQGWNSKQPETVYFASELKSLHPVCDKIEAFPPGH
IYDSKTGKTTRYFEPTWWDGERVPEKPLDLKLLRETLEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRENLRLQKLALEASNRAAAKAEAAKSENPDVGEGLVGIDDEDELSTVTYLP
QLNSFSIGLPGSPDNKAALEVAKFLGTKHHVMTFTIEDGLNALSDVIYHLESYDVTTIRA
STPMYLLSRKIKAMGIKMVLSGEGSDEEFGGYLYFHGAPDKKALHEETVRRVKNLHLSDC
LRANKSTSAWGLEARVPFLDKEFLEVAMNIDPQEKMITKERLEKYIVRKAFDTSDDPSAE
PYLPEKILWRQKEQFSDGVGYGWIDALKDNAEKHVTDEMMKNPKPEWGNDIPDSKEAYWY
RTMFDEHFPASCASTVVRWTPTWSKQTDPSGRAIAIHEQKYETA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatctttgcgtgccaccgtcaccccgacgttgagaaattcaagcccacagcc
ttgaagcttgccaaggctgtcaggcaccgtggccccgattggagcggaagcatcatcgcc
aacaacacgatcctgtgccatgagcgtctctgcattgtcggcgtcgagtccggcgcccag
cccctgacgagcaccgacgagaacattgtccttgctgtcaacggcgagatctacaaccac
cgcctcatccgcaagcacctcaagcactcataccacttcaagaccacctcggactgcgag
gttattatcccgctgtatatggagtatggcctcgacgcgccgaagcacctcgacggcatg
ttctcgtttgtcctctacgacaaggagcaggaccggacagttgccgcccgtgaccccatc
ggcatcaccaccttctaccagggctggaactccaagcagcccgagactgtgtacttcgcc
tctgagctgaagtccctgcaccccgtctgcgacaagatcgaggccttccctcctggacac
atttacgactccaagaccggcaagacgacgagatactttgagcctacctggtgggatggc
gagcgcgttcccgagaagcctctcgacctcaagctcctgcgcgagaccctcgagaagtct
gtcaggaaacgactcatggccgaggtcccctacggtgttctgctgtctggtggcctcgac
tccagtctcgtggcttcgattgcccagagggagaacctgcgcctgcagaagctggcgctg
gaggccagcaacagggccgccgccaaggctgaggctgccaagtctgagaaccccgacgtg
ggcgagggtctcgttggtatcgacgacgaggatgagctgtcgactgtcacctaccttcct
caactcaactccttctccatcggtctccccggctcgcccgacaacaaggccgccctcgag
gtggccaagttccttggcaccaagcaccatgttatgaccttcaccattgaggacggcctc
aacgccctctccgatgtcatctaccacctcgagtcgtacgacgtcaccactatccgcgcc
tctacccccatgtacctgctgtcgcgcaagatcaaggccatgggtatcaagatggtgctc
agtggtgagggcagcgacgaggagtttggcggttacctttacttccacggcgccccggac
aagaaggcgctccacgaggagacggttcgccgcgtcaagaacctgcacctttctgactgc
ctgcgcgccaacaagtcgacgtcggcgtggggtctggaggctcgcgtgcccttcctggac
aaggagttccttgaggttgccatgaacatcgaccctcaggagaagatgatcaccaaggag
aggctcgagaagtatattgtccgcaaggcgtttgacacctcggacgaccccagcgcggag
ccttacctgcccgagaagattctctggaggcagaaggagcagttctccgatggtgttgga
tacgggtggatcgacgcgctcaaggacaacgccgagaaacacgtgacggacgagatgatg
aagaaccccaagcccgagtggggcaacgatattcccgactccaaggaggcgtactggtac
cgcaccatgttcgacgaacacttccccgcgtcgtgcgcgtcgacagtcgtgaggtggacc
cctacctggtccaagcagaccgaccccagcggaagagctattgccatccacgagcaaaag
tacgagactgcatga

DBGET integrated database retrieval system