KEGG   Verticillium alfalfae: VDBG_00866Help
Entry
VDBG_00866        CDS       T02227                                 

Definition
pyrABCN
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
val  Verticillium alfalfae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VDBG_00866
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VDBG_00866
Enzymes [BR:val01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VDBG_00866
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     VDBG_00866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2203 aa AA seqDB search
MAGKTFPPATARLVDANGVDTEPLMCLELPDGSVYQGYSFGAQKSIAGELVFQTGMVGYP
ESVTDPSYRGQILVITFPLVGNYGVPSRETMDELLGDLPAHFESSQIHIAGLVAASYSGE
DYSHFLAESSLGTWLKEQGVPAIYGIDTRALTKRLRSEGSTLGRLLLETKQTLTNGTANG
LTSHASSPKYETIEWSNPNEKNLVAEVSIKTPKLYKPPASVTLKKHSSGRTIRVLCVDVG
MKYNQLRCFLKRGVEVLVCPWDHDIVAAADQYDGLFISNGPGDPAMLDVTIKNIAAALQQ
NKTPVFGICLGHQLLARASGASTTKMKFGNRGPNFPCTQHDHWKVPHPFGEPRLRRRCWL
FDGGFHPESTPGPCDTEYLFDVFIQAITDCATDASLLNSPVSFPGGTIEENERLHPRVHP
RKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIATIQTSKGLADKVYFL
PVNAEFVRKVIQYEHPDAIYVTFGGQTALSVGIQLKDEFEALGVKVLGTPIDTIITTEDR
ELFARSMDSIGEKCAKSASACTVDEAMVAVKGIGFPVIVRAAYALGGLGSGFANNEAELL
DLCNKAFAASPQVLIERSMKGWKEIEYEVVRDAQDNCITVCNMENFDPLGIHTGDSIVVA
PSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSREYCIIEVNARLSRSSALAS
KATGYPLAFIAAKLGLGIPLKDIANSVTKSTCACFEPSLDYVVVKMPRWDLKKFTRVSTQ
LGSSMKSVGEVMSIGRTFEEAIQKAIRAIDFHNLGFGATKALMSLDDELQTPSDQRLFAI
ANAMHAGYSVEKIWELTKIDKWFLNKLMGLNNFAKEMGGFNMAQITQRPDLLLQAKRLGF
SDQQLADFWSTNEIGVRRMREEGGIMPFVKQIDTVAAEFPAHTNYLYLTYNASESDVSFD
DHGIMVLGSGVYRIGSSVEFDWCSVRAIRTLRQTGHKTIMVNYNPETVSTDYDEADKLYF
ENINLETVCDIYALENAGGVLGAMGGQTPNNIALPLYRAGIKVLGTSPEMIDMAENRYKF
SRMLDSIGVDQPAWKENSSLEDAKKFCNSISYPVLVRPSYVLSGAAMNTVYSERDLENYL
EQAVAVSREYPVVITKYIENAKEIEMDAVAKDGVVVGHFISEHVENAGVHSGDATLILPP
QDLERETIERIEEATRKIGAALNVTGPFNIQFIAKDNDIKVIECNVRASRSFPFVSKVMG
VDLIEMATKAITGQPFTEYPPTTLAQNCVGVKVPQFSFSRLSGADPVLGVEMASTGEVAC
FGVDKYEAYLKALMSTGFKIPKANILLSMGSYKDKKEMLPSVEKLQKLGYKLFATAGTAD
FLQEHNIPVQYLEALGDEEGDQRSEFSLTQHLAKNTIDLYINLPSSNKYRRPANYMSKGY
QTRRMAVDYQIPLVTNVKNAKILVEAIARHFELNVGNRDFQTSHRTVSLPGLINVAAFVP
GIASSGTNDLQSVTKASLLAGFSMVRIMPVGVEGAVTDALTLKVAQKTSRRGGYCDYNLS
VSATSDNADQISQVAGEVGSLFIPFNHLSGNISKVAAVESHFDSWPEHKPIVTDAKLTDL
ASILLLASLHNRRIHVTSVSTKDDIRLIALSKKKGLKLTCDVSVFSLYLSQKDFPGCALL
PTAQDQDALWAHLDTIDVFSIGSLPYQLATSLGHSVDAAVGIADVLPLLLTSVTEGRLTI
DDIKTRLYDNPKQIFELHEQVGSGVEVEIDRSYKVPSSGAWSPFAGRTMRGSVQRVTFYG
KTACLDGNLLPSEPLGQDMSTHGAMPMSPPLKPTVQSLNKVIESPHDRRSSMFAVGPAKL
RSTDTASQLKSLEELGSPMVLQPALGSQLQDLIAQPSSWRHQNVLSVTQYTRSDLHHLFT
VAQEMRRGVQREGVLNLLRGRLLCTLFYEPSTRTSASFDAAMQRLGGRTVVISTSHSSVQ
KGETLQDTLRTLGCYGDAVVLRHPEESSVDVARKYASVPVINGGNGSKEHPTQAFLDLFT
IREELGTVQNITITFIGDLLYGRPVHSLVYLLRDYGVRVQLVSPKGLRLPEEVRNFLEQS
GQLACESEELTEEILSKSDVLYCTRVQKERFPSVEEYERVKNSYRIDNKTLRSAKKDMCI
LHPLPRNEEIAQEVDTDPRAAYFRQMRYGLYCRMALLALVMAP
NT seq 6612 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaagaccttcccccccgccacggcacgcctcgtcgatgccaatggcgttgat
accgagcctctcatgtgcctcgagctgcccgatggctctgtctaccaaggttacagcttt
ggtgcccagaagagcatcgctggagagctcgtcttccagaccggcatggtgggataccca
gagtcggtgacagacccttcgtatcgcggtcagatcctcgttatcacctttccactcgtc
ggcaactacggtgttccttcgagggagaccatggacgagctcctcggcgaccttcccgcc
catttcgagtcgtctcagattcacatcgccggcctcgtcgccgcatcctactctggcgag
gattactcgcacttcctcgccgagtcctccctcggtacctggctcaaggagcagggcgtc
cccgctatctacggcatcgataccagggccctcacgaagcgcctccgttccgagggcagc
acgctcggccgcctgctgcttgagaccaagcagaccctcaccaacggcacagcgaacggt
ctcacgtctcatgcctcgtctcccaagtacgagacgattgagtggtctaaccccaatgaa
aagaacctcgtggccgaggtatccatcaagacccccaagctttacaagccccctgccagc
gtcacgctgaagaagcactcctcgggccgcaccatccgagttctttgcgtcgatgttggt
atgaagtacaaccagctgcgatgcttcctcaagcgtggcgtcgaggtccttgtctgcccc
tgggaccacgacatcgtcgctgctgctgaccaatacgatggtctcttcatctccaacgga
cctggtgaccctgccatgcttgatgtcaccatcaagaacatcgcggctgctttgcaacag
aacaagacgcccgtctttggtatttgtttgggacatcagcttctggctcgtgcctccggt
gcgagcaccaccaagatgaagttcggcaaccgtggtcccaactttccctgcacccagcat
gatcactggaaagtgccacatcccttcggagaaccccggctacgccgtcgatgctggctc
tttgacggagggttccacccggagagcactcccggtccctgcgacacagagtatctcttc
gatgtcttcatccaggccatcaccgactgcgccactgatgccagccttctcaactcccct
gtcagcttccctggcggcactattgaggagaacgagcgcctgcaccctcgcgtccaccct
cgcaaggtccttgtcctcggaagcggtggcctcagcattggccaggccggcgaattcgac
tattctggtagtcaagccatcaaggctcttaaggaggaaggcatctacacggtgcttatc
aacccgaacatcgcgaccattcagacctccaagggtctcgctgataaggtctatttccta
cctgtcaacgccgagtttgtgcgaaaggttatccagtatgagcatcccgatgccatctac
gtcaccttcggtggccagactgctctgtcggttggtattcagctgaaggatgagttcgag
gccctcggtgtcaaggttctcggtactcccattgataccatcatcactaccgaggaccgt
gaactcttcgcgcgcagcatggactccattggtgagaagtgtgccaagtccgcttctgcc
tgcaccgttgacgaggccatggttgctgtcaagggcattggcttccccgtcatcgtccgt
gccgcgtacgctctcggcggccttggaagtggtttcgccaacaacgaggctgagctgctc
gacctttgcaacaaggcctttgctgccagtcctcaagtcctcattgagcgcagtatgaag
ggctggaaggagattgagtacgaagtcgttcgtgacgcccaagacaactgcatcactgtc
tgtaacatggagaacttcgatcctcttggaatccacactggtgattccatcgttgtcgct
ccttcgcagactctgtctgacgaagactacaacatgctgcgaacaacggccgtcaacgtt
atccgtcacctcggtgttgtcggagagtgcaacattcagtatgcgctgaaccccttttca
agggaatactgcatcatcgaggtcaacgcaaggttgtccaggtcttctgcccttgcgtcc
aaggcaactggttacccgcttgccttcattgctgctaagcttggtctcggtattcccctc
aaggacattgccaacagcgtcacaaagtccacttgtgcctgctttgagccttcgctcgat
tatgttgtcgtcaagatgcctcgttgggatctgaagaagttcacccgtgtctctactcag
ctcggctcctctatgaagagtgttggtgaagtcatgagcattggcaggaccttcgaggag
gccattcaaaaggctattcgtgccatcgacttccacaacttgggcttcggcgccaccaag
gctctgatgtccctcgatgacgagctccagaccccgtccgatcagcgtctgtttgccatt
gccaatgccatgcacgctggctactccgtcgagaagatctgggagttgaccaagattgat
aagtggttcctcaacaagctcatggggctcaacaactttgccaaggaaatgggcggcttc
aacatggcccagatcactcagcgccccgacctgctccttcaggccaagaggctcggcttc
tctgatcagcagcttgctgacttctggagcaccaacgagattggcgtccgcaggatgcgt
gaggaaggtggcatcatgcccttcgtcaagcagatcgatacggtagcggccgagttccct
gcccacaccaactacctttacctcacatacaacgcctccgagagcgatgtctcttttgac
gaccacggcatcatggtccttggttctggtgtgtaccgtatcggctcatcagtcgagttc
gattggtgctccgttcgtgccattcgcactctccgccagactggccacaagactatcatg
gtcaattacaacccggagacggtttcgactgattatgacgaggccgacaagctctacttt
gagaacatcaacctcgagacggtgtgtgacatctacgctctggagaatgcaggtggtgtt
ctcggagccatgggtgggcagacgcccaacaacatcgcactgccgctctaccgtgctggc
attaaggttctcggtacctcacctgaaatgatcgacatggccgagaaccgttacaagttc
tctcgtatgctggattcgatcggcgtggatcagcccgcgtggaaggagaacagcagtctc
gaggatgccaagaagttctgtaacagcatatcgtaccccgtgcttgtacgtccttcgtac
gtgctctctggagctgccatgaacacggtctactctgagcgtgacttggagaactacctc
gagcaggctgtcgctgtttctcgcgagtaccctgtcgtcatcaccaagtacattgagaac
gccaaggagatcgagatggatgcagttgccaaggacggcgtcgttgttggtcatttcatc
tccgagcacgttgagaatgccggtgtgcactcgggtgacgctaccctcatcttgcctcct
caggacctggagcgcgagacaattgagcgaattgaggaggctacccgcaagattggcgcc
gctctcaacgtgacgggccccttcaacattcagttcattgccaaggacaatgacatcaag
gtcattgagtgcaacgttcgtgcctcgcgttcgttccccttcgtctctaaggttatgggt
gttgacctcatcgagatggcgaccaaggccatcactggtcagcccttcaccgagtaccct
cccaccactctcgcccagaactgcgtcggtgtgaaggtgccccagttcagcttctctcgc
ctctctggtgccgatcctgttctgggtgtcgagatggcttctactggtgaagtcgcctgc
ttcggtgttgacaagtatgaggcttacctcaaggccctcatgtccaccggcttcaaaatc
cccaaggccaacattctgctgtccatgggctcctacaaggacaagaaggagatgttgcct
tctgtggaaaagcttcagaagcttggctacaagctgtttgccacggccggaactgccgat
ttcctccaggagcacaacattccagtgcagtacctcgaggctctcggtgacgaggaggga
gatcagcggtccgagttctctctgacccagcatcttgccaagaacaccatcgacctgtac
attaacttgccttccagcaacaagtatcgccgccccgccaactacatgagcaaggggtac
cagaccagacgtatggccgttgactaccagattcctctggtcaccaatgtcaagaacgcc
aagatcctcgtcgaggccattgctcgtcacttcgagctcaacgtcggcaatcgtgacttc
cagaccagccaccgcaccgtctctctgcctggtctgatcaacgtcgcggcttttgtgcct
ggcattgcctcctccggcaccaacgatcttcagtcggtcacgaaagcctcgctcctggcc
ggcttcagcatggttcgcatcatgcctgtcggtgtcgagggtgccgtgacggacgctctc
accctcaaggttgcgcagaagaccagccgtcgtggtggttactgcgactacaacctgtca
gtgtcagctacttcggacaacgctgatcagattagccaggtcgctggagaggttggatcg
cttttcatcccattcaaccatctgtctggcaacatcagcaaggtcgctgccgttgagtct
cactttgacagctggcccgagcacaagcccatcgtcaccgatgccaagctgacagacctc
gcctcgattcttctgcttgcgagcctgcacaaccgtcgcatccacgtcacctctgtgtcg
accaaggatgatatcaggctcattgcactcagcaagaagaagggtctcaagctgacctgc
gacgtgtccgtcttctccctctatctctcgcagaaggacttccccggctgtgctctgttg
cccacggctcaggatcaggatgctctgtgggctcatctcgataccattgatgtcttctcc
atcggcagtcttccttaccaactggccacttctcttggtcactctgtcgatgccgccgtc
ggtatcgccgacgtcctgcccctgctgctgacgtcagtgaccgagggtcgcctgaccatc
gacgacatcaagactcgcctctacgacaacccgaagcagatctttgagctgcacgagcag
gttggctctggcgttgaggttgagattgaccgctcctacaaggtgccctcatctggtgcc
tggtctcctttcgcggggcgcaccatgcgcggctctgtgcagcgcgtcaccttctacgga
aagacagcctgccttgacggcaacctgctgcctagcgagcctctgggccaggacatgtcg
actcacggcgctatgcccatgtccccccctctgaagcccaccgtacagtctctcaacaag
gtcatcgagtctccccacgacaggcgttcttccatgtttgctgtgggccccgccaagctg
cgatctaccgatacggccagccagctgaagagtcttgaagagctcggttcccccatggtg
ctgcagcctgctctcggctcccagctccaggacctcattgcccagccctcttcctggcgc
caccagaatgtcctttcggtcacgcagtacacgcgcagcgacctgcaccacttgttcacc
gtcgcgcaggagatgcgtcgtggtgttcagcgtgaaggtgttctcaacctcctgcgcgga
cgcctcctctgcactctcttctacgagccctctacccgcacgtccgcttcctttgacgct
gcgatgcagaggcttggtggccgcactgtggtgatctcgacatctcactcatcggtgcag
aagggcgagacgctgcaggatactctccgtactctcggttgctacggcgatgcagtcgtg
cttcgacaccccgaagagtccagcgtcgacgttgctcgcaagtacgcctctgttcccgtc
atcaacggcggcaacggcagcaaggagcacccgacgcaggcgttcctggacctgttcacg
attcgtgaggagctcggaaccgtgcagaacattaccatcacctttatcggtgatctgctg
tacggccgccccgtgcactcacttgtctatctccttcgtgactacggcgtgcgggtgcag
ctcgtgtcgcccaaggggctcaggcttcccgaggaggtccgcaacttcctcgaacagtct
ggccagctggcctgtgagtcggaggagctcacggaggagattctctccaagagcgacgtc
ctctactgcacgcgcgtgcagaaggagaggtttccctcggtggaggagtacgagcgagtc
aagaactcgtaccgcatcgacaacaagacgctgcggtcggcgaagaaggacatgtgcatc
ctgcaccccctccccaggaatgaggagattgcgcaggaggtggacacggacccgcgggcg
gcgtacttccgccaaatgcgttacggcctgtactgccgcatggctctgcttgcactcgtt
atggcgccttag

DBGET integrated database retrieval system