KEGG   Verticillium albo-atrum: VDBG_00891Help
Entry
VDBG_00891        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
val  Verticillium albo-atrum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:val04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 702 aa AA seqDB search
MKLSTVLVLATSTLALAVKKTKKLKNEDPNTYFNSVKVPPMLELTPDNFDKEINATKLVV
VKHYSPYCPHCIDYAPTYQTLYEYYYTSKPVTPEDVSFMEFYDIRFATINCVAFFDLCAS
LKVQSYPSTILYKDGQAAEIVKGVKGLDVLTTAFEPFLEAAKPGTRPKELNLPKTGDKQT
PDFSPAAAITSDTKTDAAGGAKTDDLPKAAPEEGKDKSSATPDKTTPEKTVPSPKKTIPE
APPKPTETFNPDGVSVALTAEKYETLVTGSKQPWFIKFYAPWCHHCQALAPTWAQLGKEM
KDKLNIGEVNCDVEAKLCKQVGVRAFPTLLFIKGTERAEYEGLRGLGDLKSYGEGAAAAA
VGGGRFCLLLRKATTSEDFASLEKMPVNLVGRARIVKTQDPKIAERYKITTFPRLLVSRS
GRPTYYNPLTPREMRDVEGILAWMRSVWLPMVPELVATNSREIMDGKIVVLAIINRNDAE
TLTDAKRELNKAANDWMDKQIVLFQKERQELRDAKQLKIDEAEDRGDERAKDNAKLIRVD
MSKSPRKEVAFAWIDGVFWQRWIKTTYGIDVSTGGNRVIINDEDRHRYWDVTDTNTNILL
SHTSILDMLPKVTASPPEIRAKTTLSFISKLFFDFRMSFVDHPFLSVGAVLAVMFAGAGW
VRNRMRRHRGGHFVRLDDSWSTKELMKEGLIGGGPSGNGKVD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctccacagtcctcgtgctcgccacgagtaccctcgccctcgccgtcaagaag
acgaaaaaactcaagaatgaagatccaaacacctacttcaactcggtcaaggtccctccc
atgctcgagttgacacccgacaacttcgacaaggagatcaatgcgaccaagctcgttgtc
gtcaagcattacagtccctactgcccgcactgcatcgactatgccccgacctaccaaacg
ctctacgagtactactacacctccaagcccgtcacccccgaagatgtctccttcatggag
ttctacgacattcgattcgccaccatcaactgcgttgcctttttcgacctctgtgcctcc
ctcaaggttcagtcttacccgagcaccattctgtacaaagacggccaagctgccgagatt
gtcaagggcgtcaaggggctcgacgtcctgaccacggcttttgagcccttcctcgaggcc
gccaagcccggaacccgtcccaaggagctcaacctgcccaaaaccggcgacaagcagacg
cccgacttcagccccgccgccgccatcacctctgacaccaagaccgacgccgctggcggg
gccaagactgatgaccttcccaaggcggcccctgaggagggcaaggacaagagcagtgcg
acgcccgacaagacgactcctgagaaaactgtcccgagccctaagaagacgattcccgaa
gcgcctcccaaacccaccgaaacattcaaccctgatggcgtgtcggtggccctgacggct
gagaagtacgagaccctcgttacagggtccaagcagccatggttcatcaagttctacgcc
ccttggtgccaccactgccaggccctcgcgcccacctgggcccagctcggcaaggagatg
aaggacaagctcaacattggcgaggtcaactgcgacgtcgaggccaagctctgcaagcaa
gtcggcgtccgcgcctttcccacgcttctcttcatcaaaggcacggagcgcgccgaatac
gagggtcttcgtggcctcggtgatctcaagtcgtacggcgagggtgccgcggctgcggcc
gtcggaggaggtcgtttttgtctacttctacgaaaagcgacgacgagcgaggactttgcc
tcgctcgagaaaatgcccgtcaaccttgtcggccgcgcccgcatcgtcaagacccaggac
cccaagatcgccgagcgctacaagattaccaccttcccgcgccttcttgtctcgcgcagt
ggccgcccgacatattacaacccgctgacgcctcgtgagatgcgtgacgtcgagggcatc
ctcgcctggatgcgctccgtctggctgcccatggtccccgagctggtggccaccaactcg
cgcgagatcatggatggcaagattgtcgttctcgccatcatcaaccgcaacgacgccgag
acgctgacggacgccaaacgcgagctcaacaaggccgccaacgactggatggacaagcag
attgttctcttccagaaggagcgccaggaactccgcgacgccaagcagctcaagatcgac
gaggccgaggaccgcggcgacgagcgcgccaaggacaacgccaagcttatccgcgtcgac
atgtccaagagcccccgtaaggaggttgcttttgcctggatcgacggcgtcttttggcag
cggtggatcaagacgacatacggcatcgacgtgagcaccggtggcaaccgagtcatcatc
aatgacgaggaccgccatcgctactgggatgtgaccgacaccaacaccaacattctcctt
tcccacacatccatcctcgacatgcttcccaaggtgacggcctcgccgcccgagatccgc
gccaagacgaccctctccttcatctccaagctcttcttcgatttccgcatgtcgtttgtc
gaccaccccttcctgtccgttggcgctgtcctcgccgtcatgttcgccggcgccggatgg
gtgcgcaaccgcatgcgccgtcaccgcggcggtcactttgtgcgtctggacgacagctgg
agcaccaaggagctcatgaaggagggtctcatcggtggggggcccagcggcaacggaaag
gtcgactaa

DBGET integrated database retrieval system