KEGG   Verticillium alfalfae: VDBG_00979Help
Entry
VDBG_00979        CDS       T02227                                 

Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
val  Verticillium alfalfae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VDBG_00979
Enzymes [BR:val01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VDBG_00979
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     VDBG_00979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 564 aa AA seqDB search
MKSLTSFASTLHRGCSQSAALRHVRCPHQVSIAVCRHAPRRHHFTKHAWPIAKNTTTTTT
AAFGPTTDTSAAPEPGRTKHIKTSSPVMEDDGRPVAGCGCGRRTPAGPAEPKTVTAYIAL
GSNLGDRVGWIEKACREMDDRGVRVTRTSSLWETEPMYVLEQDRFVNGACEVETKLEPLA
LLDVLQDIERTLGRQKFIDKGPRNIDLDILLYGDETISHDRLTVPHVGIPEREFVLRPLA
ELIPAKPLYASNPWKLTQDYLNELTPSHPPLSPLTPLAPAPAPFITALTPTRKTHVMAIV
NITPDSFSDGGVHTSTSLPDTLLAAHAAGATMIDIGGQSSAPGRPDVSAEEEIARVVPAI
RLVRSIPELAHLPISIDTYRAPVAEAALAAGADFVNDISAGQLDRDMLPLVARAGATVCL
MHMRGTPQTMSSLNDYPDGLIPTVARELLERVAEAEAAGIRRWRIVLDPGLGFAKVGEQN
LELLSRLPELRAWPGLEGFPWLIGSSRKSFIGRVTGVPKAEERIWGTAATVAAAVSGGAD
VVRVHDAVEMCQVVRMSDAIFRRR
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactcacctcttttgcctccactctgcacaggggctgctcccagtcagccgcg
ctccgccatgtccgctgccctcaccaggtgtccattgccgtctgccgtcacgctccccgt
cgacaccacttcaccaagcacgcctggccaatagccaaaaacacgacgactaccaccacg
gccgcgttcggccccaccacggacacgtcagcggcgcctgagcccggcaggaccaagcac
atcaagacgagcagccccgtcatggaggacgacggcagacccgtcgccggctgcggctgc
ggccgtcgcacccccgccggccccgccgagcccaagaccgtcacggcctacattgccctc
ggcagcaacctcggcgaccgggtcggctggatcgaaaaggcctgccgtgagatggatgac
cgcggtgtccgcgtgacgaggaccagcagcctgtgggagacggagcccatgtacgtccta
gagcaagatagattcgtcaatggagcatgtgaggtcgagacaaagttggagcccctcgcc
ctgctggacgtactgcaggatatcgagaggacgctgggtcgacaaaagttcatcgacaag
gggccccggaacatcgacctcgacattcttctgtacggtgatgagacgatcagtcatgac
cgtctcaccgtccctcacgtcggcattcccgaaagggagtttgtgctgcgaccacttgcc
gaactcatccccgccaaaccgctctacgcctcaaacccctggaagctcacccaggactac
ctcaatgagctcaccccctctcatccgcctctttcccccctgacgcccctcgcgccggcg
ccggcgcccttcatcacggccctcacgccgacccgcaaaacacatgtcatggccatcgtc
aacatcacccccgactctttctcagacggcggcgttcacacctcgacatccctgccggac
actctccttgccgctcacgccgccggtgccaccatgatcgacattggcggccagtcctca
gccccgggtcgccccgacgtgtcggccgaggaggagatcgcgcgcgtcgttccggccatc
cgtctcgtccgctccatccctgagctcgcccacctccccatcagcatcgatacgtaccgc
gcccccgtcgccgaggctgccctcgctgcaggcgccgactttgtcaacgacatatccgcc
ggccagctagaccgtgacatgctgcccctcgtcgctcgcgctggcgccaccgtctgcctc
atgcacatgcgcggcaccccacagaccatgtcttctctgaacgactaccccgacggcctc
atccccaccgtcgcccgcgagctccttgagcgcgtcgccgaggccgaggccgctggtatc
cgccgctggcgcattgtgctcgaccccggcctcggcttcgccaaggtgggcgagcagaac
ctcgagctcctgagccgactgcccgagctgcgggcctggcccggcctcgagggctttccc
tggctcatcggctctagccgcaagagcttcatcggccgcgtcactggcgtccctaaggcc
gaagagcgcatctggggcactgccgccaccgtcgccgcggccgtctctggcggcgccgac
gtcgtgcgggttcatgacgctgtcgagatgtgccaggtcgtaagaatgtcggatgctatc
tttcgaaggagatga

DBGET integrated database retrieval system