KEGG   Verticillium alfalfae: VDBG_01114Help
Entry
VDBG_01114        CDS       T02227                                 

Definition
palmitoyl-protein thioesterase
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
val  Verticillium alfalfae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VDBG_01114
  Lipid metabolism
   00062 Fatty acid elongation
    VDBG_01114
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     VDBG_01114
Lipid biosynthesis proteins [BR:val01004]
 Fatty acid synthase
  Component type
   VDBG_01114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 283 aa AA seqDB search
MKSILPYSLLALGCLATASRQSPVSIAAADADDDTPLPLIIWHGLGDSFDGEGIQQVAEL
ADAAFPGIYVHIVKVGADPNADRSATFFGNVSTQLEQGLRRHRRRPHPLLGPGRRRHRLL
PGRPVPSRLRGALQRAPPYYRDPAPAEYEKYIESSNFLADINNERATKNSAYADNVARLV
NFVMIMFEHDTTVIPKETSWFEEVNGTESLPLRARKLYTEDWIGLRALDRKGGLKFRKVP
GEHMQFTNEQLNATMHEFLGPASKKFAAEAPELPLQDAWSQEL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgattcttccttacagcctgcttgctctaggttgcctggccacggcatccagg
cagagccctgtatctatcgccgctgccgatgccgacgatgatacgcctcttcccctcatc
atctggcatggcctaggcgactcgttcgacggtgaaggcattcagcaggtcgctgaactg
gccgatgccgccttccccggcatctacgtccacatcgtcaaggttggcgccgaccccaat
gccgaccgttcggctaccttctttggcaacgtctcgacccagctcgagcagggtttgcgc
cgacatcgccgccgaccccatcctctcctcggccccggccgtcgacgccatcggcttctc
ccagggcggccagttccttcgcggctacgtggagcgctgcaacgcgctcccccgtactac
cgcgacccggcccccgccgagtatgagaagtacatcgagtcgtccaactttctcgccgac
atcaacaacgagcgcgcgacgaagaacagcgcctacgccgacaacgtggcccgcctcgtc
aactttgtcatgatcatgttcgagcacgacacgaccgtcatccccaaggagacgtcgtgg
ttcgaggaggtcaacggcaccgagagcctgccgctgcgcgcgcgcaagctgtacaccgag
gactggatcggcctgcgcgcgctcgaccgcaagggcggcctcaagttcaggaaggtgccc
ggcgaacacatgcagttcaccaacgagcaactcaacgccacgatgcacgagttcctcggt
ccagcttccaagaagtttgccgccgaggcgcccgagctgcctctgcaagacgcatggtct
caggagctgtaa

DBGET integrated database retrieval system