KEGG   Verticillium albo-atrum: VDBG_01234Help
Entry
VDBG_01234        CDS       T02227                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
val  Verticillium albo-atrum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:val00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 281 aa AA seqDB search
MSITFLRHIRPTKAITAIAAGGIGLGIYSRMMTGSAHADSGSPPKVFGSGPAFVSLPLES
SEVVNHNTKRLRFRLPDENAVSGLALTSAVLTMSWPKGRWFPVARPYTPISPSDGKQSTH
LHSLSPGETLLFAAALKGPAWKPNAVPHVTLIAGGAGITPIYQLAQGILRNPEDKTRITL
VFGINTDVDALLKTEFDAFEKEFPGRFEAIYTVSRPEAGSLLRQGHVTKALLEQVAPNPT
KQDTKVFVCGPPAMEATLVGSRGSPGVLEQLGYRKDQIHTF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcacttttttacgtcatatccggccgacaaaagccattacggccatcgctgcc
ggtggcatcggtctgggcatttactcccgcatgatgaccggcagtgctcatgctgattcg
ggaagcccaccaaaggtattcggcagtggtcctgctttcgtttcattgcctttagagagt
agcgaagttgtcaatcacaacaccaagcgtctccgtttcaggttaccggacgaaaacgcg
gtcagtgggctagctctcacctccgccgttttgaccatgtcatggccaaaaggccgatgg
ttcccagtagcaagaccatatacaccaatcagtccatcagacggaaagcagagcacgcac
ctgcactcattatcgcctggcgaaacactcctcttcgctgctgcgctcaaaggccccgca
tggaagccaaatgccgttccccacgtcacgctgattgctggcggggctggcattaccccg
atctatcagctagcccaggggattctgcggaatcctgaagacaagacaagaatcacgctc
gtgttcggcatcaatacggatgtggatgccctgttgaaaaccgagtttgacgccttcgag
aaggagtttcccggtcggtttgaagccatctacaccgtgagccggccggaggcgggctct
ctactccgacagggtcatgtcacgaaggcgcttcttgaacaagttgcacccaatcccacc
aagcaagacaccaaggtctttgtttgcgggccaccggcgatggaggcgacgttggttggc
tcgaggggttcaccaggtgttttggaacagttgggatatcgaaaggatcagattcacact
ttctga

DBGET integrated database retrieval system