KEGG   Verticillium albo-atrum: VDBG_01425Help
Entry
VDBG_01425        CDS       T02227                                 

Definition
sphingoid long chain base kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
val  Verticillium albo-atrum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:val00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MAAPGHAAAPKPVSSAGSADTNGINGHANGDGEKTITINGNHVLTLQQKHVVLEHTAQEA
YEEGSGICGLSLGTAGSPDTTIALYNVLWAERDGTNLHITHAQPTSKHKFRPVTATVDIS
ANSAEAVDQLVEALLSRAYGRAKRQKRAKVLVNPHAGPGGAVHKWHHDVEPLFKAARMTI
DMQKTVRSGEAIAIARDLDIAQFDTIVACSGDGLPHEIINGLGARADSRHALEKIAVCQI
PCGSGNALSCSTFGTYQAGEAALALIKGVDTVIDLTSITTGEERKLSFLSQVVGIIAEAD
LGTEHMRWMGNHRFTVGVAQRIFKKKAYPCDVAVKIELDDKETIRAHYREKLNAAPVTMT
KADGAGLPPLKYGTINDALPEDGWVSVKYDNMGNFYAGNMPLVAPESNFFPASLPNDGLL
DLVTIDSDISILKQIGILTAVGDDSTFFFRQCRRQLPQGDGVPVHAARPEDGYISIDGEK
FPLPLSRRDPSGARQDVFKDGATLNHARCAMYVRSRYHQQGQIIFSLVRQG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccccggacacgcggccgccccgaagccagtgtcgagtgctggctcggcagac
acgaacggcatcaacggacacgccaatggagacggcgaaaagacaatcacgatcaacggc
aaccacgtcttgaccctgcaacagaaacacgtcgtcctggagcacacagctcaggaggca
tacgaagaaggtagtggcatctgcggcctttcgctcgggaccgctggctcacccgatacc
acgatcgctctctacaatgttctctgggccgagcgcgatggcaccaacctccacatcacc
catgcccagccgacgtccaaacacaagttccgccctgtgacggccacggtggacatctcg
gccaacagcgccgaagctgtcgatcagctggtcgaggcactgctctccagagcctacggc
cgggccaagcgccagaagagggccaaggtgcttgtcaacccccacgcaggccccggaggc
gccgtccacaagtggcaccacgatgtcgagcctctgttcaaggcggcccgcatgacgatt
gacatgcaaaagactgtgcggtccggcgaggccattgcgattgctcgcgacctcgacatt
gcccagttcgacaccattgttgcgtgttctggggatgggctcccccacgagatcatcaac
gggctcggtgcccgcgccgactcgcgtcacgcgctcgagaaaattgccgtgtgccagatc
ccctgcggctcgggcaacgccctgtcgtgcagcacgtttgggacgtaccaagctggtgag
gctgccctggccctcatcaagggcgtagatacggtcatagacttgacgagcatcacgacg
ggcgaggagcgcaagctcagcttcctcagccaggtggtgggcatcatcgccgaggccgac
ctcggcacggagcacatgcgatggatgggcaaccaccgattcacggtcggcgtggcgcag
aggatcttcaagaaaaaggcgtatccctgtgatgttgccgtcaagatcgagctggacgac
aaggagaccattcgagcgcattaccgagagaagctcaatgccgcgccggtgacgatgacc
aaggcagacggcgccggcctgcctccgctcaagtacggcacgatcaacgacgcgctgcct
gaggacggctgggtgtcggtcaagtacgacaacatgggcaacttttatgccggcaacatg
cccctcgtggcgcccgagtccaactttttcccagcgtcgctgcccaacgacggactgctc
gaccttgtcacgattgacagcgacatatccatcctgaagcagattggcatattgacggcc
gtgggcgacgacagcactttcttttttcgccaatgccgacgtcagctaccgcaaggtgac
ggcgtaccggttcacgccgcgcgaccagaagacggctacatcagcattgacggcgagaag
tttccgttgcccctttccaggcgagatccatccggggctcggcaagacgtattcaaagac
ggggcgacgttgaatcatgcaaggtgcgccatgtatgttcgcagcaggtaccaccagcaa
ggccaaattatattttcgctagtgaggcaaggctag

DBGET integrated database retrieval system