KEGG   Verticillium alfalfae: VDBG_01425Help
Entry
VDBG_01425        CDS       T02227                                 

Definition
sphingoid long chain base kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
val  Verticillium alfalfae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VDBG_01425
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     VDBG_01425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MAAPGHAAAPKPVSSAGSADTNGINGHANGDGEKTITINGNHVLTLQQKHVVLEHTAQEA
YEEGSGICGLSLGTAGSPDTTIALYNVLWAERDGTNLHITHAQPTSKHKFRPVTATVDIS
ANSAEAVDQLVEALLSRAYGRAKRQKRAKVLVNPHAGPGGAVHKWHHDVEPLFKAARMTI
DMQKTVRSGEAIAIARDLDIAQFDTIVACSGDGLPHEIINGLGARADSRHALEKIAVCQI
PCGSGNALSCSTFGTYQAGEAALALIKGVDTVIDLTSITTGEERKLSFLSQVVGIIAEAD
LGTEHMRWMGNHRFTVGVAQRIFKKKAYPCDVAVKIELDDKETIRAHYREKLNAAPVTMT
KADGAGLPPLKYGTINDALPEDGWVSVKYDNMGNFYAGNMPLVAPESNFFPASLPNDGLL
DLVTIDSDISILKQIGILTAVGDDSTFFFRQCRRQLPQGDGVPVHAARPEDGYISIDGEK
FPLPLSRRDPSGARQDVFKDGATLNHARCAMYVRSRYHQQGQIIFSLVRQG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccccggacacgcggccgccccgaagccagtgtcgagtgctggctcggcagac
acgaacggcatcaacggacacgccaatggagacggcgaaaagacaatcacgatcaacggc
aaccacgtcttgaccctgcaacagaaacacgtcgtcctggagcacacagctcaggaggca
tacgaagaaggtagtggcatctgcggcctttcgctcgggaccgctggctcacccgatacc
acgatcgctctctacaatgttctctgggccgagcgcgatggcaccaacctccacatcacc
catgcccagccgacgtccaaacacaagttccgccctgtgacggccacggtggacatctcg
gccaacagcgccgaagctgtcgatcagctggtcgaggcactgctctccagagcctacggc
cgggccaagcgccagaagagggccaaggtgcttgtcaacccccacgcaggccccggaggc
gccgtccacaagtggcaccacgatgtcgagcctctgttcaaggcggcccgcatgacgatt
gacatgcaaaagactgtgcggtccggcgaggccattgcgattgctcgcgacctcgacatt
gcccagttcgacaccattgttgcgtgttctggggatgggctcccccacgagatcatcaac
gggctcggtgcccgcgccgactcgcgtcacgcgctcgagaaaattgccgtgtgccagatc
ccctgcggctcgggcaacgccctgtcgtgcagcacgtttgggacgtaccaagctggtgag
gctgccctggccctcatcaagggcgtagatacggtcatagacttgacgagcatcacgacg
ggcgaggagcgcaagctcagcttcctcagccaggtggtgggcatcatcgccgaggccgac
ctcggcacggagcacatgcgatggatgggcaaccaccgattcacggtcggcgtggcgcag
aggatcttcaagaaaaaggcgtatccctgtgatgttgccgtcaagatcgagctggacgac
aaggagaccattcgagcgcattaccgagagaagctcaatgccgcgccggtgacgatgacc
aaggcagacggcgccggcctgcctccgctcaagtacggcacgatcaacgacgcgctgcct
gaggacggctgggtgtcggtcaagtacgacaacatgggcaacttttatgccggcaacatg
cccctcgtggcgcccgagtccaactttttcccagcgtcgctgcccaacgacggactgctc
gaccttgtcacgattgacagcgacatatccatcctgaagcagattggcatattgacggcc
gtgggcgacgacagcactttcttttttcgccaatgccgacgtcagctaccgcaaggtgac
ggcgtaccggttcacgccgcgcgaccagaagacggctacatcagcattgacggcgagaag
tttccgttgcccctttccaggcgagatccatccggggctcggcaagacgtattcaaagac
ggggcgacgttgaatcatgcaaggtgcgccatgtatgttcgcagcaggtaccaccagcaa
ggccaaattatattttcgctagtgaggcaaggctag

DBGET integrated database retrieval system