KEGG   Verticillium alfalfae: VDBG_01554Help
Entry
VDBG_01554        CDS       T02227                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
val  Verticillium alfalfae
Pathway
val00260  Glycine, serine and threonine metabolism
val00750  Vitamin B6 metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01230  Biosynthesis of amino acids
Module
val_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VDBG_01554
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VDBG_01554
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VDBG_01554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 9533449
NCBI-ProteinID: XP_003007366
UniProt: C9SAJ7
AA seq 424 aa AA seqDB search
MAAYTFPPRSPRPKTGSPGRTSPSPSSPLRSSLSTSPPPRFPRKISRESLRGLFHGPTFA
FKDVALQFLGNLFEYFLVRKNEGKTGRDRHHLTVVGATSGDTGSAAIYGLRGKKDVSVFI
LHPKGRVSPIQEAQMTTVLDDNVHNLAVTGTFDDCQDIVKALFADPEINKTHNLGAVNSI
NWARILRPGALREARGSRRRGPPVGLAQDGAKAHEDGAKETLNPAMDILVSNNFESLLWF
LAYEFASSVGMGDEWNKKQAGQEVTTWLSELKTKGASAPSTRTSARTCSTAHGVASRVAA
SIERSGPEVPHILLSAAPPGPSLPALLSWRSKDEAGFDFAGKGAAAGVCRAREQGEEGVG
GGGRLEAGAHCGDEAGRGGAQRPLELKRRGEKRVSASPSWSRGAQERNGVSPGGVRASAT
TWKR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctatacattccctccgagatcccccaggccgaaaactggcagtcctggaagg
acaagtccttcaccgagctcgcctttgagatcctctctctctacatctcctccgccgaga
ttccctcggaagatctcaagggaatcattgagaggactcttccacggcccgacctttgcc
ttcaaggacgtcgctctgcagttcctcggcaacctgttcgagtacttcctcgtgaggaag
aacgagggcaagacgggacgtgacaggcatcaccttactgtcgtcggcgccacgagcggt
gacacgggctccgccgccatctacggcctcaggggcaagaaggatgtgtccgtgttcatc
ctccaccccaagggtcgtgtgtcccccattcaggaggcccagatgaccaccgtcctcgac
gacaatgtccacaaccttgccgtgaccggcacatttgatgactgccaggacattgtcaag
gccctcttcgccgaccccgaaatcaacaagacgcacaaccttggtgccgtcaactcgatc
aattgggctcgcattctccgcccaggtgcgctccgagaagcacgaggctcacggcgccga
gggccgccggtgggcctcgcccaggacggtgccaaggcgcacgaggacggtgccaaggag
acgctgaatccggccatggacattctcgtgtccaacaactttgagagtcttctctggttt
ctcgcgtacgagtttgcctcgagcgtcggcatgggtgatgagtggaacaagaagcaggcg
ggccaggaggtcacaacgtggctgtcagagctcaagaccaagggcgcttcggccccgtct
acaaggaccagcgcgcgtacgtgctcgaccgcacacggcgtcgcgtcgcgcgtcgctgcg
tcgatcgagcgcagcgggcccgaggttccgcacatcttgctgtcggcggcgccacccggc
ccaagtttgccggcgctgttgagctggcgctcaaaggacgaggccggctttgactttgcc
ggcaaaggtgctgccgcaggagtttgtcgggctcgagagcaaggagaagagggtgtcgga
ggtggcggccgactggaagcaggtgcgcactgtggtgacgaagcaggtcgaggaggagct
caaaggccactcgagctaaaaagaaggggggaaaaaagagtttctgcttctccatcgtgg
agtcgaggtgcgcaagagaggaacggggtctcgccagggggggttagagcgtcggcaacg
acatggaaacgctga

DBGET integrated database retrieval system