KEGG   Verticillium alfalfae: VDBG_01701Help
Entry
VDBG_01701        CDS       T02227                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
val  Verticillium alfalfae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VDBG_01701
Messenger RNA biogenesis [BR:val03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     VDBG_01701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 358 aa AA seqDB search
MSGLFGSASSSSASNTVGDLKSDVALSNPPEDTVSDLAFSPATNQTNDFLAISSWDKKVR
IYEVTGNGQSEGRHAYDHEGPVFNVDFSKDGTKVISGGADKVVKCCDLGSRQEVKVGEHD
QPVRSVRFFESSGNQMVVSGSWDKTVKYWDMRQQAPAATLQCQDRVYSLDVKNDLLVIGT
ADRYINIVNLKNPTTFYKTLQSPLKWQTRVVSCFTDAAGFAIGSIEGGAPFQYVEDKDSS
LNFSFKCHRDPPQNNITNVFAVNDISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPNV
GGSITSTKFNKNGSIFAYAVGYDWSKGFQHNTQQLQTKVMLHPVQQDECKPRPTMKKR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacttttcggcagcgcgtcgtcttcgtcggccagcaacaccgtcggcgacctt
aagtcggatgtcgccctgagcaacccgcccgaagacaccgtctccgaccttgccttttct
cccgccacaaatcagaccaacgacttcctcgccatctccagctgggacaagaaggtcagg
atatacgaggtcacgggcaacggccagagcgaaggaaggcacgcatacgatcacgaggga
cccgtcttcaacgtcgacttttccaaggatggcacaaaggtcatttcgggcggcgcagac
aaggttgtaaagtgctgcgacctcggctcgcggcaagaagtcaaggtcggcgagcacgat
cagccagtgcgcagcgtgcgcttcttcgaatcaagcggcaaccagatggtcgtgtccggc
tcgtgggacaagacggtcaagtactgggatatgcgacagcaggcgcccgccgcgacgttg
cagtgccaggaccgcgtctactccctcgacgtcaagaacgacctcctcgtcatcggcacg
gcggaccgctacatcaacattgtcaacctcaagaaccccacgaccttttacaagacgctg
cagagccctctcaagtggcagacgcgcgtcgtgagctgcttcaccgacgccgctgggttt
gctatcggcagtatcgagggcggtgcgccattccagtatgtcgaggacaaggacagcagc
ctaaacttttcattcaagtgccaccgcgacccgccgcagaacaacatcaccaacgtcttt
gccgtcaacgacatctccttccaccccgtgcacggcaccttcagcaccgccggctcggac
ggaacgttccacttctgggacaaggacgccaagcaccgcctcaagggctaccccaacgtc
ggcggaagcatcacgtcgacaaagttcaacaagaacggctccatctttgcctacgccgtg
ggctacgactggtccaagggcttccagcacaacacgcaacagctgcagaccaaggtcatg
ctccaccctgtgcagcaggatgagtgcaagcccaggcccacaatgaagaagcggtaa

DBGET integrated database retrieval system