KEGG   Verticillium albo-atrum: VDBG_01748Help
Entry
VDBG_01748        CDS       T02227                                 

Definition
WD repeat-containing protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
val  Verticillium albo-atrum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1430 aa AA seqDB search
MFVFQSTIYSAAGAVGHDISYNKVFVGSVESRSMMLGIQRSRFKWTSQMAITGMGLPCIM
ALCTRFPRQQQRRQQSTPDYHQANGGLSTSAAGVTMATRAPRSNGIHTQLGGPELSKMQR
PRSPLTLNQRSNTHTGHETPDARPSSAPGDNQKQDAGPGGFAHHRNPGQGSNGQPRRQQP
KPLLLRTRSEFGVRPNDSDQSDEEIPQWGARHGFDELYESQQFMDKLANNWYMYWTDKRH
ESTGKPKASSHELQDWRMRDRLKTVSAALAVCLNISVEPPDQLRTNPGAKLEAWTDPYHP
APQKALENIGKQLQSQYETLAIRTRYKQYLDPSVEETKKFCVSLRRNAKDERVLLHYNGH
GVPKPTASGEIWVFNKNYTQYIPVSLYDLQHWLQAPTIFVWDCSEAGNILNNYHRFVEKH
EQEEDEQAARDSNYEKTAFQPYIHLAACGVKENLPTNPLLPADLFTACLTTPIEMALWFF
VLQNPLKTNCTPEQAKKLPGRLQERRTPLGELNWIFTAITDTIAWTTLPRHLFRKFFRQD
LMVAALFRNFLLAQRVMSVYGCHPQSFPELPDTKQHPLWASWDLAVDMALAQLPMLQKKE
NDGIDYEYQNSTFFTEQLTAFEVYLARGDAMSQKPPEQLPVVLQVLLSQQHRVRALILLG
SFLDLGPWSVQLALSIGIFPYVLKLLQSAAAELKPVMVFIWTRILAVDISCQQDLIKDNG
YNYFAAILKPTEALPVSNSDEHKAMCAFILAMLCRGYKPGQHVCNQTDIMTYCLAHLQHQ
DNPLLRQWACLCLSQLWNDLPEAKWRGIRENAPSQLSVLTKDRCPEVRAAMLHAMTTFIG
IIDLTDEVARVEESIAWTLLDMANDGSPMVRREFLVFLSHFILRFESKFIVAAVEQLQEE
KEYLLFPPEIDGLENKMGLHYTRQENRNVDGTIKPSAHGFAHNTVFAACWKHALMLNVDP
HPEVQRDATTIVDYMHNALLASPVGEHAQALMDDIRRRAKRASARSQHAANNRHGVLGAS
PSSTNAPLPSPGLLRRTASYLFTGMFGANGAMEPGRTMNQSNPVPSSPGLPRSASQKFRG
PELASAPPDQIDQTNYSKYHTANEPVSGGYEERSVGEISSLPLRSTFLDWSVEYFREPQM
KPSESDEPGSTEYNERLWRRSRNETILQDTQPLKQYAGSHKWDNQVRLINNGAQPAKMTF
HQFEDQLAVADNGNTVYVWDWKKQSRLSKFSNGNPEGSKISDMKFINEDDQGFLMTGSSD
GVIRVYRNYDSDDAGRTSVVQESMVKKWKDDTDRQWIKSVHMQRGGQRELISASRNGKVK
LWDIRMDKPLHTFQTTKDPRDTVRTASTHEHLPVFAVGTSARRVQVFNFDGQELSEMEPY
SSFLQQNRGLPISATAFHPHRPILGTAARGDHHINLFTCENAEMLQPRSY
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtctttcaatcaactatctactcggctgcaggggccgttggtcatgacatctcc
tacaacaaggtgttcgtcggttctgtcgaatcgagaagcatgatgcttggtattcaaaga
tcacgcttcaagtggaccagtcagatggctatcactggaatggggcttccttgcataatg
gcgctgtgcacacgcttcccgcgacagcagcagcgacggcagcagtccacaccggattac
caccaagccaacggcggcctatccacaagtgctgcgggtgtgacaatggcgacgcgagct
ccgcgttcgaacggcattcatactcaattgggcggcccggagctgagcaagatgcaacga
ccgagatcacccttgactctcaatcagcgatctaatacccacactggtcacgagacgccc
gatgcgcgcccgtcaagtgcacccggagataatcagaagcaggatgcggggcctggaggc
ttcgcgcaccatcgcaaccctggacaaggcagcaacggacagccgaggcgacagcagccc
aaaccgctgctcctccgtacaaggagcgagtttggcgttcgaccgaacgattctgatcag
tcagatgaggaaataccccaatggggcgcgaggcatggcttcgacgagctctacgaatcg
cagcagttcatggacaagctggccaataactggtacatgtactggaccgacaagcgccac
gagtcgacgggcaagccgaaggcctcgtctcatgaacttcaggactggcgcatgcgcgac
cggctcaaaacggtgtcagctgcgcttgctgtgtgtttaaacatctctgtggaaccgcca
gatcaactcagaacgaaccccggggccaagttagaggcatggacggacccttaccatcca
gcaccccaaaaggctttggaaaacataggaaaacaactccagagccagtacgaaacactc
gcgatccggacacggtacaagcaatatctggatccatcggttgaggagaccaaaaagttc
tgtgtatccttacgaaggaacgccaaggacgagcgagttctcctccactacaacggacac
ggcgtacccaaaccaaccgcgagcggagagatctgggtcttcaataagaattacacccag
tacatccccgtctcgttgtatgatctacagcattggctgcaggcgccgaccatttttgtt
tgggactgctctgaagcgggcaatattctaaataactaccaccgctttgttgagaagcac
gaacaagaagaagatgagcaggctgctcgggactccaattacgagaagacggcttttcag
ccatacattcacctcgccgcctgcggtgtcaaagaaaacctgcctaccaatcctctcctc
cctgcggatctcttcacggcttgccttacaacaccgattgaaatggctctgtggttcttt
gtgctgcagaatccgctgaagaccaactgtacacccgagcaggcaaaaaagctaccgggt
agactccaagagcgtagaacgcctctaggggagctgaactggatcttcacagccatcacg
gatacaattgcatggacaactctacctcgacatctttttaggaagtttttccggcaagac
ctcatggtagcagctttgttcaggaatttcctgctcgcgcagagagtcatgtccgtctac
ggctgccatccccagtcattccccgagcttccggataccaagcagcacccgctctgggcg
agttgggatcttgctgtcgacatggcgctggcgcagcttcccatgctacaaaagaaagag
aacgatggtatcgactacgagtatcaaaactcgacattcttcacagagcagttgacagcc
ttcgaggtttacctcgcaagaggtgacgcaatgtcacagaagcccccagagcagctcccc
gttgtcctgcaggtcttgcttagccagcaacacagggttcgggcgttgatccttttgggc
agctttctcgatcttggcccttggtcagtgcagttggccttgagcatcggcatcttccca
tacgttctgaagctgctgcagtcggctgcagccgagctaaagcctgtcatggtctttatt
tggactaggattctcgcagtcgacatctcctgccagcaggatctcatcaaggataacggc
tacaactattttgctgctattttgaagcctactgaagcccttcctgtctcgaacagcgac
gagcacaaggcgatgtgcgccttcattcttgctatgttgtgcaggggctacaagcctggt
caacatgtctgcaaccagacagatattatgacatactgtcttgcccacctacagcaccag
gacaaccccctacttcggcaatgggcttgtctctgccttagccagctatggaacgacctc
ccggaggcgaagtggcgcggcatcagagagaacgccccgagtcagctctccgttcttacc
aaagaccgctgtcccgaggtcagggctgcaatgttgcatgccatgaccacattcatcggc
atcatcgatctaacggacgaggttgcgcgtgtcgaagaatccatcgcctggacgctactg
gacatggcgaacgacggaagtccaatggttcgccgtgagttccttgtcttcttgtctcac
tttattcttcgcttcgaaagcaagttcattgtcgctgctgtagagcagctgcaagaagaa
aaggaataccttctgtttccgccagaaatcgacggcttggagaacaagatgggtctgcat
tacaccaggcaggagaaccgcaatgttgatggaaccatcaagccttcagcacatggtttt
gcacacaacaccgtctttgccgcttgttggaagcatgctcttatgctaaacgttgatcct
caccccgaggtccagcgcgatgctaccaccattgttgactacatgcataacgcgttgctc
gcgtcacctgtcggtgagcatgctcaagcgttgatggacgacattcgaagaagggcgaag
cgcgcctctgccagaagccagcacgctgctaataataggcatggcgttctcggtgcatca
ccatcatccacaaacgctccactgccgtccccaggactcctgcgtaggaccgcgagctac
ctgttcaccggcatgtttggagcgaacggagcaatggaacccgggagaaccatgaaccaa
agcaaccccgttccttcttcgcctggcctacctcggagtgcctctcaaaagttccgagga
cctgagctggcttccgctcctccagaccagattgatcagaccaactactccaaatatcac
acagccaacgagcccgtatccggcggctacgaagagcgcagcgtgggggaaatttcgtcg
ctccctcttcgcagcaccttcctagattggtctgtagaatacttccgtgagcctcagatg
aagccgagtgagtcggatgagccgggaagtacggagtacaacgagcgcctttggagaagg
tctcgcaatgagacgattctccaagacacccagcccctgaagcagtatgccggcagccac
aagtgggacaatcaggttcgacttatcaacaatggcgcccaacctgccaagatgactttc
catcagttcgaagaccagcttgcggtggcagataacggcaacactgtgtatgtctgggat
tggaagaagcagtcacgtctcagcaagttctccaacggcaaccccgagggctccaagatc
agcgacatgaagttcatcaatgaggacgatcaaggtttccttatgacaggatcctctgat
ggtgtcatcagggtgtaccgaaactatgattcagacgacgcaggtcgaactagcgtcgtc
caagagtcgatggtgaagaagtggaaggacgacacggacaggcaatggatcaagagtgtc
cacatgcaacgtggaggtcagagagagctcatcagcgctagccgcaacggcaaggtaaag
ctatgggacatacgcatggacaagccccttcacacgttccaaacgacgaaggacccacga
gatactgtgcgcacggccagtacccatgagcatttgcccgtgtttgctgtcggcacatcg
gcccgacgagttcaggtcttcaactttgatggtcaggagctatctgagatggagccgtac
tccagcttccttcaacagaatcgaggccttcccatctctgctacagcgttccatcctcac
agacccattctgggaactgctgctagaggcgatcatcatatcaatctctttacttgcgag
aatgcagagatgctacagcctcgctcctactaa

DBGET integrated database retrieval system