KEGG   Verticillium alfalfae: VDBG_01777Help
Entry
VDBG_01777        CDS       T02227                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
val  Verticillium alfalfae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VDBG_01777
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VDBG_01777
   00630 Glyoxylate and dicarboxylate metabolism
    VDBG_01777
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VDBG_01777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MVVNALNADVFTYMADFEDSSAPTWDAMVNGQVNLYDANRRQVDFKQGPKEYKLRTDRTL
PTLIVRPRGWHLEEKHVSVDGEPMSASLFDFGLYFFHNARQTLDIGIGPYFYLPKMESHL
EARLWNDAFNLAQDYLHIPRGTVRATVLIETILAAFEMDEIIYELRDHSAGLNCGRWDYI
FSVIKKFRSNPNFVLPDRSAVTMTSPFMDAYVKLLIQTCHRRGVHAMGGMAAQIPIKDDK
AANDRAMDGVRADKLREVRAGHDGTWVAHPALASIAVDVFNKHMPTPNQLFVRREDVRVG
AQDLLNMNVPGRITADGIRKNLLIGLGYMEAWLRGVGCVPINFLMEDAATAEVSRSQLWQ
WVRHGVKTDDGTTVDKGYALKVLRECTTELAGKAPKGHKYQLAAQYFAGQVTGEDYADFL
TTLLYDEITAVGSASPASKL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtcaacgctctcaatgccgacgtcttcacctacatggccgactttgaggactcc
tccgcccccacctgggacgctatggtcaacggccaggtcaacctctacgacgccaaccgc
cgccaggtcgacttcaagcaagggcccaaggagtacaagctccgcaccgaccgcaccctg
cctaccctcatcgttcgccctcgtggctggcatctcgaggagaagcacgtctccgttgac
ggcgagcccatgtccgcctctctcttcgactttggtctctacttcttccacaatgcccgt
cagactctcgacattggcattggcccctacttctacctccccaagatggagtcccacctc
gaggctcgcctctggaacgatgccttcaaccttgcccaggactacctccacatcccccgc
ggcaccgtccgggccaccgtcctcatcgagaccatcctcgccgcgtttgagatggacgag
atcatctatgagctgcgcgatcactctgccggcctcaactgcggtcgttgggactatatc
ttcagcgtcatcaagaagttccgctccaaccccaacttcgtcctgcccgatcgcagtgcc
gtcaccatgaccagtcccttcatggatgcctatgtcaagctcctcatccagacctgccac
cgccgtggcgtccacgccatgggcggcatggctgcccagatccctatcaaggatgacaag
gctgctaacgaccgcgccatggacggtgtccgcgccgacaagctccgtgaggttcgtgct
ggccacgatggcacatgggttgctcaccctgccctggcttccatcgccgtcgatgtcttc
aacaagcacatgcccactcccaaccagctctttgttcgccgcgaggacgtccgtgtgggc
gcccaggacctcctcaacatgaatgtcccaggtcgcatcaccgccgacggtatccgcaag
aacctgctgattggtcttggttacatggaggcgtggctccgtggtgtcggctgcgtgccc
atcaacttccttatggaggacgccgccaccgccgaggtgtcccgcagccagctctggcag
tgggtgcgccatggcgtcaagacggatgatggcaccactgtcgacaagggttacgcgctg
aaggtcctgcgtgagtgcaccacggagctggctggcaaggcgcccaagggtcacaagtat
cagcttgctgcacaatactttgcaggtcaagtgacgggcgaagactatgccgactttttg
acgacgcttctgtacgatgagatcacagctgttggcagcgcgagtcccgcgtccaagttg
tag

DBGET integrated database retrieval system