KEGG   Verticillium albo-atrum: VDBG_01827Help
Entry
VDBG_01827        CDS       T02227                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
val  Verticillium albo-atrum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:val00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MRQRRQRMVQIVDPEAVPQAEQESESTLPVDSPLKRQFSAGIAKRLSGRNLPMSSSRTSL
SSLGGQEAVETPEESSEQQQQQQQQHHSHGHGHGHERRKQHYVSQKLLSQVSDWLEHERR
KREQRKSGSQASSSRRKRPQQQQETQVQAQAPAQAPAADTTTAVPDEKGQDGFPFRHRTD
SIDSQSSDMSFDKLQRILEENMAALGLDSIPHLGPKLPQRPSVRGHKKSGSRSMLHRTAS
SDTDYADGDVVVPSCDAVLDNSKTMSYNAGKSSDNLVSGKAEAKEHEAWSTFRNEIIRLA
HTLRIKGWRRIPLEAGDKISVQRLSGALTNAVYVVTPPEDLEPVPGKKQPSKVLLRIYGP
QVEHLIDRDNELSVLGRLARKRIGPRLLGTFTNGRFEEYFNSVTLTPKDLRDAETSKQIA
KRMRELHDGIELLDAERKAGPSVWGNWDKWLDNVEKRVMAVDDETRARQAGEPVKPTSTY
QGQGFVCGVEWSQFRATVEKYRAFLTSFYRSEEDINARLTFAHNDTQYGNILRVRPDDKK
SPLLKPANEHKQLIVIDFEYAGANVPGQEFANHFTEWAYNYHDEAKPHGCSIERYPTVEE
QRRFIRSYVEHRPKFPHASSTPRLTPLDTPGGGGGHASGGTPVLHPTSSSSSIVDFMLDA
RVPAGQWKEDERLREEQTEKTVTELMEESRLWRTANSAQWIAWGIVQAKVPACLEGDDVA
DEGGEASAPSAGDGEQGQDGEKKDDGEDEFDYWGYARERALFFWGDCVLLGLVKAEELPE
DLRASLKLVER
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaacgacgacaacgcatggtccaaattgttgatcccgaggcggtgccccaggct
gagcaggagtccgagtctactctacccgtcgactcgcccctgaaaaggcagttctctgcc
ggcattgccaagcgactcagtggccgcaacctgcccatgagctcctcgcgcacctctctg
tcgagtctgggcggccaagaagccgtagagacccccgaagagtcgtctgagcagcagcag
cagcagcagcagcagcatcacagtcatggccacggccatggccacgagcgacgcaagcag
cactacgtcagtcagaagcttctttcgcaggtgtctgactggctcgaacatgaacgccgt
aaacgagaacaacgcaaatcaggaagtcaagcttcatcgtcgaggagaaagcgccctcag
cagcagcaagagacccaggtccaggcccaggccccggctcaagcaccagctgccgacacg
acgactgccgtgcccgacgaaaagggccaggatggctttcccttccgccatcgcaccgac
tcgattgattctcagtccagcgacatgagtttcgacaaattgcagcgcatcctcgaggag
aacatggccgctctaggcctcgactccattccgcatctcggccccaagctgcctcagcgt
ccttccgtgaggggacacaaaaagtccggctcgcggagcatgctgcatcgtaccgccagc
tccgacacggattatgccgacggcgacgtcgtcgtgccatcttgcgatgccgttctcgac
aacagcaagaccatgagctacaacgccggcaagagctccgacaatctcgtgtctggcaag
gcagaggccaaggagcacgaggcatggtccaccttccgaaacgagattatccgcctggcg
cacacgctacgtatcaagggctggcgtcgtatccccctcgaggcaggcgacaagatctcc
gtccagaggctgagcggcgcgctgaccaacgccgtctacgtcgtcacaccccccgaggac
ctggaacccgtccccggcaagaagcagccgagcaaggttctcctgcgcatctacggcccc
caggttgagcatctcatcgaccgtgacaatgagctcagcgttctcggtcgtctagcgagg
aagcgcattgggcctcgcctcctgggcacgtttaccaacggccgcttcgaggagtacttc
aactcggtgactctgacacccaaggacctgcgagacgcggagacgtccaagcagattgcc
aagcgcatgcgcgaattgcacgacggcatcgagctcctcgacgctgagcgcaaggccggg
ccctctgtctggggcaattgggacaagtggctggacaacgtggagaagcgagtcatggcc
gtcgacgacgagacgcgcgccaggcaagccggggagccggtcaagccaacaagcacctac
caaggtcagggcttcgtgtgcggcgtggagtggtctcagttccgtgccactgttgagaag
taccgcgctttcctgacgagcttctaccggagcgaggaagacatcaacgcccgtctgacg
tttgctcacaatgatacccaatacggcaacattctgcgtgttcggcccgacgacaaaaag
tcgcccctcctcaagccggccaacgagcataagcagctcatcgtcatcgactttgagtat
gctggcgccaacgtccccggccaggagttcgccaaccacttcaccgagtgggcctacaac
taccacgacgaggccaagccgcacggctgctcgatcgagcggtacccgaccgtcgaggag
cagcgacgcttcatccggtcctatgtcgagcaccggcccaaattcccgcatgccagctcg
acgccgcgcctgacgcccctcgacacgcccggtggcggcggcggccatgccagcggcggc
acgcccgtgctgcaccccacgagctcgtcgagctctatcgtcgactttatgctcgacgcg
cgtgtgcctgcgggtcagtggaaggaggacgagcgactgcgcgaggagcagacggagaag
acggtgacggagctcatggaggagtcgaggctgtggcggacggccaacagcgcgcagtgg
atcgcctggggtatcgtacaggccaaggtgcctgcctgtctagagggtgatgatgtcgct
gacgagggtggcgaggcgtcggcacccagcgccggagacggggagcagggacaggacggg
gagaagaaggacgacggcgaggacgagtttgactactgggggtatgcacgagagcgggcc
ctcttcttctggggcgattgcgtgctactgggcttggtgaaggcggaggagcttccagag
gatctgcgggcgagcctgaagctggtcgagaggtag

DBGET integrated database retrieval system