KEGG   Verticillium alfalfae: VDBG_01934Help
Entry
VDBG_01934        CDS       T02227                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
val  Verticillium alfalfae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    VDBG_01934
Enzymes [BR:val01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     VDBG_01934
Glycosyltransferases [BR:val01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   VDBG_01934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 944 aa AA seqDB search
MAPPSVAPSSKLAEKPVANSSKTIAKRQKKTSYKSDGVKDNDVFLLPGTDYQIVVALTIL
AAIVRLFRIYQPSSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALTGWLAGFDGNF
DFKEIGKDYVEPGVPYVAMRMFPAICGILLAPAMFLTLKATGCRTTTATMGSALIIFENG
LLTQARLILLDSPLMVATAFTALAFTSFTNQHELGPEKAFQLSWWFWLVMTGLGLGTTLS
IKWVGLFTIAWVGSLTLVQLWVLLGDTKTVTLRIWFKHFFARVFCLIVIPLTFYLAMFAI
HFVCLVNPGDGDGFMSSEFQSTLNNKGMKDVAADVIMGSRVSIRHVNTQGGYLHSHPLMY
PTGSKQQQITLYPHKDDNNVWMLQNQSQPLDINGQAINGTSAWDDLDPVYIKNGAVLRLY
HTQTNRRLHSHDVRPPVTEADWQNEVSAYGYEGFDGDANDYFRVEIVKKQSISAVAKERL
RTIETKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCAKGGTLPNSLWYIEANQHPKLGE
DVEKVNYRHPGFFGKFWELQRVMWKTNAGLVDSHAWDSRPEAWPVLKRGINFWGRQNRQI
YLLGNPIVWWSSTLAIAVYVLFKAFAVLRWQRNCGDYSNTIFKRFDYEIGTSVLGWAFHY
FPFYLMARQLFLHHYFPALYFAVIAFCQIFDFFTARLPIFQKNTIVNKAGAVIFLALTVA
VFVLFSPLAYGNQWTKAECNRVKLFGTWDFDCNTFPTDYAQYSQTATISSAGAEQTPSKS
SKKKSKKPKASKGAVVENEGAEAQKPLENVNEEAVSGAAEIPADRIVAREERIEYRDQDG
NLLDDEQVKALEGKVEFKTKYETRTRVVDENGNEVQVPGEEAGVVAPPHPDVEGVDPETK
QKVADADSKVPEAAESIKGEREAEQKKPKPASEGGKEATVKEEL
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggctccaccaagcgtggccccgagctccaagctcgcagagaaacccgtcgccaactcg
tccaagacgattgcgaagaggcagaagaagacgagctacaagtccgatggcgtcaaggac
aacgatgtctttctgcttcccggcacagactaccagattgtcgtcgctctgaccattctc
gccgccattgtgcgcctgttccgcatctaccagccttccagcgtcgtcttcgatgaggtt
cacttcggtggcttcgcgtcgaaatatatcaagggaaaattctttatggatgtccatcca
cctctcgccaagatgcttatcgcattgaccggctggctcgctggtttcgatggcaacttc
gacttcaaggagattggcaaggactacgttgagcctggtgtaccctacgtggccatgcgc
atgttccctgccatctgcggtatccttctcgcgcccgccatgttcctcactctcaaggcc
actgggtgccgcaccacaacggccaccatgggctctgccctgattatttttgagaacggc
cttcttacccaggctcgcctcattcttctcgattcgcccttgatggtcgccactgccttc
accgctctcgccttcacctccttcaccaaccagcacgaacttggccccgagaaggcattc
cagctcagctggtggttctggctggttatgactggtctgggactcggtaccaccctcagc
atcaagtgggttggcctcttcaccattgcctgggtcggcagcttgacgctggttcagctg
tgggttctgctcggcgacaccaagacggtcactctgcgcatctggtttaagcacttcttc
gcccgtgtcttctgcctcatcgtcattcctctgacgttctacctggccatgtttgccatt
cactttgtgtgcctcgtcaaccctggcgacggcgacggcttcatgagctccgagttccaa
tcgaccctcaacaacaagggcatgaaggatgtcgcggccgatgtcatcatgggtagccgg
gtcagcatcaggcacgtcaacacacagggcggttacttgcactcgcaccccttgatgtac
cccaccggcagcaagcagcagcagatcaccctgtacccccacaaggacgacaacaacgtt
tggatgctgcagaaccaatcgcagcctcttgacatcaatggccaggcgatcaacggcacc
agtgcctgggatgatctggaccccgtctacatcaagaacggcgccgtccttcgcctgtac
cacactcagaccaaccgacgtctccattcccacgatgtccgccctcctgtcaccgaggct
gactggcagaacgaagtctctgcgtacgggtacgagggttttgacggtgatgccaacgat
tacttccgtgtcgaaatcgtcaagaagcagtctatcagtgccgtggccaaggagcggctc
cgcaccattgagaccaagttcaggctcgttcacgtcatgaccggttgcgttctcttctcg
cacaaggtcaagctccccgactgggcttccgagcagcaagaggtcacctgcgccaagggt
ggtaccctccccaacagcctgtggtacattgaggccaaccagcatcccaagctcggagaa
gatgtcgagaaggtcaactaccgtcaccccggcttcttcggcaagttctgggagctacag
cgtgtcatgtggaagaccaacgctggcctcgtcgattctcacgcctgggactcccgtccc
gaggcctggcccgtcctgaagcgaggcatcaacttctggggcaggcagaaccgccagatt
tatctcctcggcaaccccatcgtctggtggagctctactctggccatcgccgtctatgtt
ctcttcaaggcgtttgccgttctccgttggcagcgcaactgcggtgattactccaacacc
attttcaagcgttttgactacgagatcggaacctctgttctcggctgggctttccactat
ttccctttctacctcatggctcgtcagcttttcctgcaccactacttccccgctctttac
tttgccgtcattgcgttctgccagatcttcgactttttcactgcccgccttcccatcttc
cagaagaacactattgtcaacaaggccggcgctgtcattttcctcgctctgaccgtcgcc
gtctttgtccttttctctccccttgcctatggcaaccagtggaccaaggccgagtgcaac
cgtgtcaagcttttcggcacttgggactttgactgcaacaccttccccacggactatgct
cagtactctcagaccgcaactatctcttccgctggtgccgagcagacgccttcaaagtct
tcaaagaaaaagtccaagaagcccaaggcgtccaagggcgctgtcgtggagaacgaaggg
gctgaggcccagaagccgctcgagaacgtcaacgaggaggctgtttcgggcgccgccgag
atccccgcggatcgcatcgtggcccgcgaggagcgcatcgagtaccgcgaccaggacggc
aacctgctcgacgacgagcaggtgaaggctctcgaaggcaaggttgagttcaagaccaag
tacgagacgcgcactcgcgtcgtcgacgaaaacggcaacgaggtgcaagtcccgggcgag
gaggccggcgtcgtcgccccccctcaccctgacgttgagggcgtcgaccccgagacgaag
cagaaggtcgcggacgccgactccaaggtgcccgaggctgccgagagcatcaagggcgag
cgtgaggccgagcagaagaagcccaagcccgccagtgagggtggcaaggaggccaccgtc
aaggaggagctgtga

DBGET integrated database retrieval system