KEGG   Verticillium alfalfae: VDBG_01963Help
Entry
VDBG_01963        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VDBG_01963
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_01963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MATIPIVVKHSGKKYDVEVDTTANGETLKYQLYSLTGVEPERQKILVRGGPLKDEADMSK
LAFKPGQVIMMMGSPADGSATLTRPKEAIKFVEDMTEAEAAQQEGATPAGLINLGNTCYL
NSTLQTLRSIPELQQSLTTYKAKGPAPRPVQGSLGLQPVSQADLATPLVDLYKMMAETQD
SVAPHTFLTVLRSVYPQFAEKSKQGNGFAQQDAEEAWSQIVSQLKQRLGEGEDSSFIDKY
MAGAMTSTLEADEQDARDGGEETSKSTETFFKLNCHIDGTINHLRDGIAAGLTEKIEKRS
AVLDRDTNFTKKSQISRLPKYLTVHFVRFFWRRDTQKKAKIMRKVVFPHELDAVEFCNDE
LKSMLIPVRDKVREIRKDEEDVQRARKRRKINANDRGDVAGSSGAPQEKTALEKANEKKA
PVSQLPKVSGDGDTEMTETYKTDAEFDAERDASLLTLKKELDGLINPALRQDEGANQSGL
YELRGVVTHQGSSADSGHYTASARCHRHPSMAGGWWRVSLCAHPVVQGHSPADSRGAEQL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatacccattgtcgtcaaacactctggcaaaaaatacgacgttgaggtcgat
accactgccaatggagagactctcaaataccagctctacagtctgacgggcgtcgagcct
gaacgccagaagatcctcgtccggggtggacccctcaaggatgaagccgacatgtcgaag
ctagccttcaagcccggccaggtcatcatgatgatgggctcgcccgccgatggcagtgct
accctcactcgacctaaagaggctatcaagtttgtcgaggacatgacggaagcagaggcc
gcacagcaagagggcgcaactccagctggccttatcaaccttgggaacacctgctacctc
aactcgactctccagacccttcgatccatcccggagctccaacagagcctgactacatac
aaggccaagggcccagcccctcgccctgtccagggctctcttggcctgcaacccgtctcg
caggctgacctggctacacctcttgtcgacctgtacaagatgatggcggagacccaggac
agcgtggcgccccacacatttctgaccgtgctgcgttccgtgtatcctcagttcgccgaa
aaatctaagcaaggcaatggctttgctcagcaggacgccgaagaggcatggtcgcagatt
gtgagccaactcaagcagcgcctgggtgaaggagaggattcttccttcatcgacaagtac
atggccggagcaatgacttcgacactcgaagccgatgagcaggatgctagagacggcggc
gaggaaacaagcaagtcaaccgagactttcttcaagctgaactgtcacattgacggcaca
atcaatcaccttcgggacggcattgcggcgggcctcacggaaaagattgagaagagatcg
gcggtactcgaccgtgacacgaactttaccaagaagtcacagatctcgcggctgccaaag
tacttgacggtccattttgtccgtttcttctggcgccgtgatactcaaaagaaggcgaag
atcatgcgaaaggttgtgttcccacacgaacttgatgctgttgagttctgcaacgatgaa
ctcaagtcgatgctcattcccgtccgcgacaaggttcgcgagatccgcaaggatgaggag
gatgtgcagcgggctcgcaagaggcgcaagattaacgccaacgatcgcggcgacgttgct
gggtcctctggcgccccacaggagaagacggcactggagaaggccaacgagaagaaggca
cccgtgagccagctgcccaaggtgtcgggcgacggcgacacagagatgacagagacttac
aagacggatgccgagtttgacgcggagcgcgatgcatctcttctgacgctcaagaaggag
ctggacggactcatcaacccggccctcaggcaggacgagggtgccaatcagtcgggcttg
tacgaactccgtggtgtggtgacgcaccagggctcgagcgccgacagcggtcattacaca
gcgtcagcgaggtgccatcgacatccatcgatggctggcgggtggtggcgagtctcactc
tgcgctcatcctgttgtacaaggccattcccctgccgacagcagaggagccgagcagcta
aagtag

DBGET integrated database retrieval system