KEGG   Verticillium albo-atrum: VDBG_01963Help
Entry
VDBG_01963        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MATIPIVVKHSGKKYDVEVDTTANGETLKYQLYSLTGVEPERQKILVRGGPLKDEADMSK
LAFKPGQVIMMMGSPADGSATLTRPKEAIKFVEDMTEAEAAQQEGATPAGLINLGNTCYL
NSTLQTLRSIPELQQSLTTYKAKGPAPRPVQGSLGLQPVSQADLATPLVDLYKMMAETQD
SVAPHTFLTVLRSVYPQFAEKSKQGNGFAQQDAEEAWSQIVSQLKQRLGEGEDSSFIDKY
MAGAMTSTLEADEQDARDGGEETSKSTETFFKLNCHIDGTINHLRDGIAAGLTEKIEKRS
AVLDRDTNFTKKSQISRLPKYLTVHFVRFFWRRDTQKKAKIMRKVVFPHELDAVEFCNDE
LKSMLIPVRDKVREIRKDEEDVQRARKRRKINANDRGDVAGSSGAPQEKTALEKANEKKA
PVSQLPKVSGDGDTEMTETYKTDAEFDAERDASLLTLKKELDGLINPALRQDEGANQSGL
YELRGVVTHQGSSADSGHYTASARCHRHPSMAGGWWRVSLCAHPVVQGHSPADSRGAEQL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatacccattgtcgtcaaacactctggcaaaaaatacgacgttgaggtcgat
accactgccaatggagagactctcaaataccagctctacagtctgacgggcgtcgagcct
gaacgccagaagatcctcgtccggggtggacccctcaaggatgaagccgacatgtcgaag
ctagccttcaagcccggccaggtcatcatgatgatgggctcgcccgccgatggcagtgct
accctcactcgacctaaagaggctatcaagtttgtcgaggacatgacggaagcagaggcc
gcacagcaagagggcgcaactccagctggccttatcaaccttgggaacacctgctacctc
aactcgactctccagacccttcgatccatcccggagctccaacagagcctgactacatac
aaggccaagggcccagcccctcgccctgtccagggctctcttggcctgcaacccgtctcg
caggctgacctggctacacctcttgtcgacctgtacaagatgatggcggagacccaggac
agcgtggcgccccacacatttctgaccgtgctgcgttccgtgtatcctcagttcgccgaa
aaatctaagcaaggcaatggctttgctcagcaggacgccgaagaggcatggtcgcagatt
gtgagccaactcaagcagcgcctgggtgaaggagaggattcttccttcatcgacaagtac
atggccggagcaatgacttcgacactcgaagccgatgagcaggatgctagagacggcggc
gaggaaacaagcaagtcaaccgagactttcttcaagctgaactgtcacattgacggcaca
atcaatcaccttcgggacggcattgcggcgggcctcacggaaaagattgagaagagatcg
gcggtactcgaccgtgacacgaactttaccaagaagtcacagatctcgcggctgccaaag
tacttgacggtccattttgtccgtttcttctggcgccgtgatactcaaaagaaggcgaag
atcatgcgaaaggttgtgttcccacacgaacttgatgctgttgagttctgcaacgatgaa
ctcaagtcgatgctcattcccgtccgcgacaaggttcgcgagatccgcaaggatgaggag
gatgtgcagcgggctcgcaagaggcgcaagattaacgccaacgatcgcggcgacgttgct
gggtcctctggcgccccacaggagaagacggcactggagaaggccaacgagaagaaggca
cccgtgagccagctgcccaaggtgtcgggcgacggcgacacagagatgacagagacttac
aagacggatgccgagtttgacgcggagcgcgatgcatctcttctgacgctcaagaaggag
ctggacggactcatcaacccggccctcaggcaggacgagggtgccaatcagtcgggcttg
tacgaactccgtggtgtggtgacgcaccagggctcgagcgccgacagcggtcattacaca
gcgtcagcgaggtgccatcgacatccatcgatggctggcgggtggtggcgagtctcactc
tgcgctcatcctgttgtacaaggccattcccctgccgacagcagaggagccgagcagcta
aagtag

DBGET integrated database retrieval system