KEGG   Verticillium alfalfae: VDBG_01963Help
Entry
VDBG_01963        CDS       T02227                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_01963
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_01963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MATIPIVVKHSGKKYDVEVDTTANGETLKYQLYSLTGVEPERQKILVRGGPLKDEADMSK
LAFKPGQVIMMMGSPADGSATLTRPKEAIKFVEDMTEAEAAQQEGATPAGLINLGNTCYL
NSTLQTLRSIPELQQSLTTYKAKGPAPRPVQGSLGLQPVSQADLATPLVDLYKMMAETQD
SVAPHTFLTVLRSVYPQFAEKSKQGNGFAQQDAEEAWSQIVSQLKQRLGEGEDSSFIDKY
MAGAMTSTLEADEQDARDGGEETSKSTETFFKLNCHIDGTINHLRDGIAAGLTEKIEKRS
AVLDRDTNFTKKSQISRLPKYLTVHFVRFFWRRDTQKKAKIMRKVVFPHELDAVEFCNDE
LKSMLIPVRDKVREIRKDEEDVQRARKRRKINANDRGDVAGSSGAPQEKTALEKANEKKA
PVSQLPKVSGDGDTEMTETYKTDAEFDAERDASLLTLKKELDGLINPALRQDEGANQSGL
YELRGVVTHQGSSADSGHYTASARCHRHPSMAGGWWRVSLCAHPVVQGHSPADSRGAEQL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatacccattgtcgtcaaacactctggcaaaaaatacgacgttgaggtcgat
accactgccaatggagagactctcaaataccagctctacagtctgacgggcgtcgagcct
gaacgccagaagatcctcgtccggggtggacccctcaaggatgaagccgacatgtcgaag
ctagccttcaagcccggccaggtcatcatgatgatgggctcgcccgccgatggcagtgct
accctcactcgacctaaagaggctatcaagtttgtcgaggacatgacggaagcagaggcc
gcacagcaagagggcgcaactccagctggccttatcaaccttgggaacacctgctacctc
aactcgactctccagacccttcgatccatcccggagctccaacagagcctgactacatac
aaggccaagggcccagcccctcgccctgtccagggctctcttggcctgcaacccgtctcg
caggctgacctggctacacctcttgtcgacctgtacaagatgatggcggagacccaggac
agcgtggcgccccacacatttctgaccgtgctgcgttccgtgtatcctcagttcgccgaa
aaatctaagcaaggcaatggctttgctcagcaggacgccgaagaggcatggtcgcagatt
gtgagccaactcaagcagcgcctgggtgaaggagaggattcttccttcatcgacaagtac
atggccggagcaatgacttcgacactcgaagccgatgagcaggatgctagagacggcggc
gaggaaacaagcaagtcaaccgagactttcttcaagctgaactgtcacattgacggcaca
atcaatcaccttcgggacggcattgcggcgggcctcacggaaaagattgagaagagatcg
gcggtactcgaccgtgacacgaactttaccaagaagtcacagatctcgcggctgccaaag
tacttgacggtccattttgtccgtttcttctggcgccgtgatactcaaaagaaggcgaag
atcatgcgaaaggttgtgttcccacacgaacttgatgctgttgagttctgcaacgatgaa
ctcaagtcgatgctcattcccgtccgcgacaaggttcgcgagatccgcaaggatgaggag
gatgtgcagcgggctcgcaagaggcgcaagattaacgccaacgatcgcggcgacgttgct
gggtcctctggcgccccacaggagaagacggcactggagaaggccaacgagaagaaggca
cccgtgagccagctgcccaaggtgtcgggcgacggcgacacagagatgacagagacttac
aagacggatgccgagtttgacgcggagcgcgatgcatctcttctgacgctcaagaaggag
ctggacggactcatcaacccggccctcaggcaggacgagggtgccaatcagtcgggcttg
tacgaactccgtggtgtggtgacgcaccagggctcgagcgccgacagcggtcattacaca
gcgtcagcgaggtgccatcgacatccatcgatggctggcgggtggtggcgagtctcactc
tgcgctcatcctgttgtacaaggccattcccctgccgacagcagaggagccgagcagcta
aagtag

DBGET integrated database retrieval system