KEGG   Verticillium albo-atrum: VDBG_02117Help
Entry
VDBG_02117        CDS       T02227                                 

Definition
mitogen-activated protein kinase spm1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
val  Verticillium albo-atrum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:val04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MADLQGRKIFKVFNPRFHRRRALHRYEGASAAVNSGSNEGVAIKKVTNVFSKKILAKRAL
REIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQPLTDAHFQS
FIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEY
VATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTP
NEETLSRIGSPRAQEYVRNLPFMTKKPFPQLFPQANPDALDLLDRMLAFDPSSRISVDQA
LEHPYLHIWHDASDEPDCKTTFNFDFEVVDDVGEMRKMILEEVYRFRQFVRTVPGGGQGG
TQAAQQAAAGQVPIPSGHGQWSTEDPRPQEYQAHGGGLEADLAGGLDHRR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctccagggacgcaagatcttcaaggtcttcaacccaagatttcatcgtcga
cgagcgctacaccgttacgaaggagctagcgccgccgtcaacagtggaagcaacgagggc
gtcgccatcaagaaggtcaccaatgtcttcagcaagaagatcctcgccaagcgcgccctc
cgcgagattaagctcctccagcattttaggggccaccgaaacatcacttgtctctacgac
atggatattccccgccccgacaactttaacgaaacgtacctctacgaggagttgatggag
tgcgacttggccgccatcattcgctctggccagcccctgaccgatgctcacttccagtcc
ttcatttatcagatcttgtgtggtttgaaatacatccactccgccaatgtgcttcaccgt
gacttgaagcccggcaacttgctggtcaatgccgactgcgagctcaagatttgcgacttt
ggcctggctcgcggcttctccgtcgatcccgaggagaacgctgggtacatgaccgagtat
gtcgccacgcgttggtaccgcgcgcccgagattatgctgagcttccagagctacaccaaa
gctattgatgtctggtccgttggctgcatccttgccgagcttttgggcggccgccccttc
ttcaagggccgcgactacgtcgaccagctgaaccagattcttcacatcctcggtaccccc
aacgaggagacgctttccaggattggctccccgcgtgcgcaagagtacgtgcgcaacttg
ccgttcatgaccaagaagccgttcccccaactcttcccccaggcgaaccctgacgcgctt
gacctgctcgaccgcatgcttgctttcgacccctcaagccgcatcagcgtcgaccaggct
ctcgagcacccgtatctccacatttggcatgatgcctccgacgagcccgattgcaagacg
acattcaactttgactttgaggtcgtcgacgacgttggtgagatgcgcaagatgatcctc
gaggaggtgtaccgcttccgtcagtttgtccgcaccgtccccggcggcggtcagggaggc
acgcaggccgcccagcaggccgccgctggccaggtgcccatcccttcgggccatggccag
tggagtaccgaagaccccaggccgcaggaataccaggcccacggcggaggtctggaggcc
gacctcgcaggcggactcgaccaccgaaggtga

DBGET integrated database retrieval system