KEGG   Verticillium alfalfae: VDBG_02117Help
Entry
VDBG_02117        CDS       T02227                                 

Definition
(RefSeq) mitogen-activated protein kinase spm1
Organism
val  Verticillium alfalfae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MADLQGRKIFKVFNPRFHRRRALHRYEGASAAVNSGSNEGVAIKKVTNVFSKKILAKRAL
REIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQPLTDAHFQS
FIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEY
VATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTP
NEETLSRIGSPRAQEYVRNLPFMTKKPFPQLFPQANPDALDLLDRMLAFDPSSRISVDQA
LEHPYLHIWHDASDEPDCKTTFNFDFEVVDDVGEMRKMILEEVYRFRQFVRTVPGGGQGG
TQAAQQAAAGQVPIPSGHGQWSTEDPRPQEYQAHGGGLEADLAGGLDHRR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctccagggacgcaagatcttcaaggtcttcaacccaagatttcatcgtcga
cgagcgctacaccgttacgaaggagctagcgccgccgtcaacagtggaagcaacgagggc
gtcgccatcaagaaggtcaccaatgtcttcagcaagaagatcctcgccaagcgcgccctc
cgcgagattaagctcctccagcattttaggggccaccgaaacatcacttgtctctacgac
atggatattccccgccccgacaactttaacgaaacgtacctctacgaggagttgatggag
tgcgacttggccgccatcattcgctctggccagcccctgaccgatgctcacttccagtcc
ttcatttatcagatcttgtgtggtttgaaatacatccactccgccaatgtgcttcaccgt
gacttgaagcccggcaacttgctggtcaatgccgactgcgagctcaagatttgcgacttt
ggcctggctcgcggcttctccgtcgatcccgaggagaacgctgggtacatgaccgagtat
gtcgccacgcgttggtaccgcgcgcccgagattatgctgagcttccagagctacaccaaa
gctattgatgtctggtccgttggctgcatccttgccgagcttttgggcggccgccccttc
ttcaagggccgcgactacgtcgaccagctgaaccagattcttcacatcctcggtaccccc
aacgaggagacgctttccaggattggctccccgcgtgcgcaagagtacgtgcgcaacttg
ccgttcatgaccaagaagccgttcccccaactcttcccccaggcgaaccctgacgcgctt
gacctgctcgaccgcatgcttgctttcgacccctcaagccgcatcagcgtcgaccaggct
ctcgagcacccgtatctccacatttggcatgatgcctccgacgagcccgattgcaagacg
acattcaactttgactttgaggtcgtcgacgacgttggtgagatgcgcaagatgatcctc
gaggaggtgtaccgcttccgtcagtttgtccgcaccgtccccggcggcggtcagggaggc
acgcaggccgcccagcaggccgccgctggccaggtgcccatcccttcgggccatggccag
tggagtaccgaagaccccaggccgcaggaataccaggcccacggcggaggtctggaggcc
gacctcgcaggcggactcgaccaccgaaggtga

DBGET integrated database retrieval system