KEGG   Verticillium alfalfae: VDBG_02174Help
Entry
VDBG_02174        CDS       T02227                                 

Definition
(RefSeq) protein kinase DC2
Organism
val  Verticillium alfalfae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MAAVVSQSKTEPVTPHEKPTRPRASTSSSSHREPGFLSRMKSRMANGKGHHNAGHGPIAS
RAQLSSHDFRIIRTLGTGTFARVCLVRPVNPSEEEKKEVFALKILRKTEVIKLKQVDHVR
HERHILGDVSGHPFITNMIAAFSDADTLYMLLDYVPGGELFSYLRKMRRFDESTAKFYTA
EIVLVLEFLHEQQGRVAYRDLKPENLLLDKNGHIKLVDFGFAKRLSSEDGQPTETYTLCG
TPEYLAPEVIHNKGHTTAVDWWALGILLYEFLTGYPPFWHQNPIEIYKQIVEKPVTFPAE
PHISDNAKDLIKSFCTVDRSKRLGNMNGGAQRVKDHPFFKGIRWDELLGQRVRGPIVPPV
RSSSDSQCFDQYPEEDGKREPYTDEMARQYDQYFKDF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcgtgtcacaatccaagacggagcccgtcacgcctcatgagaagccgacg
cgtccgcgcgcctccacctcgtcttcttcccaccgcgagccgggctttctctcgcgcatg
aagagtcgcatggccaacggcaagggccaccacaatgccggtcacgggcccattgccagc
cgcgcccagttgagctctcacgacttccgcatcatccgcaccctcggcaccggcacgttt
gctcgtgtctgcctcgtcagacccgtcaatccgtccgaggaggagaagaaggaggtcttc
gccctcaaaatcctccgcaagaccgaggtcatcaagctcaagcaggtcgaccacgtgcgc
cacgagcggcacatcctcggcgacgtctccggccaccccttcatcaccaacatgattgcc
gccttctccgacgctgacacgctctacatgctgctcgactacgtccccggcggcgagctc
ttcagctacctgcgcaagatgcgccgcttcgacgagagcaccgccaagttctacacggcc
gagattgtgctcgtcctcgagtttctgcacgagcagcagggccgcgtcgcctatcgcgat
ctcaagcccgagaatctgctgctcgacaagaacggccacatcaagctcgtcgactttggc
ttcgccaagcgcctcagcagcgaagacggccagccaaccgagacgtacaccctctgcggc
acccccgagtacctcgcacccgaggtgatccataacaagggccacacgaccgccgtcgac
tggtgggcgctgggcattctgctgtacgagttcctcaccggctacccgccgttttggcac
cagaaccccatcgagatttacaagcagatcgtcgagaagcccgtcacgttcccggcggaa
ccgcacatttcggacaatgccaaggatctcatcaaatcgttctgcaccgtcgaccgctcc
aagcgcctcggcaacatgaacggtggcgcgcagcgcgtcaaagaccaccccttcttcaaa
ggcatccggtgggatgagctgctgggacagcgcgtgcgcggacccattgtgccgcccgtg
cgatcctcgagcgactcgcagtgcttcgatcagtatcccgaggaagatggcaagcgcgag
ccgtatacggacgaaatggcgcgccagtacgaccagtactttaaagatttttga

DBGET integrated database retrieval system