KEGG   Verticillium alfalfae: VDBG_02174Help
Entry
VDBG_02174        CDS       T02227                                 

Definition
protein kinase DC2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
val  Verticillium alfalfae
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    VDBG_02174
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     VDBG_02174
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   VDBG_02174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MAAVVSQSKTEPVTPHEKPTRPRASTSSSSHREPGFLSRMKSRMANGKGHHNAGHGPIAS
RAQLSSHDFRIIRTLGTGTFARVCLVRPVNPSEEEKKEVFALKILRKTEVIKLKQVDHVR
HERHILGDVSGHPFITNMIAAFSDADTLYMLLDYVPGGELFSYLRKMRRFDESTAKFYTA
EIVLVLEFLHEQQGRVAYRDLKPENLLLDKNGHIKLVDFGFAKRLSSEDGQPTETYTLCG
TPEYLAPEVIHNKGHTTAVDWWALGILLYEFLTGYPPFWHQNPIEIYKQIVEKPVTFPAE
PHISDNAKDLIKSFCTVDRSKRLGNMNGGAQRVKDHPFFKGIRWDELLGQRVRGPIVPPV
RSSSDSQCFDQYPEEDGKREPYTDEMARQYDQYFKDF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcgtgtcacaatccaagacggagcccgtcacgcctcatgagaagccgacg
cgtccgcgcgcctccacctcgtcttcttcccaccgcgagccgggctttctctcgcgcatg
aagagtcgcatggccaacggcaagggccaccacaatgccggtcacgggcccattgccagc
cgcgcccagttgagctctcacgacttccgcatcatccgcaccctcggcaccggcacgttt
gctcgtgtctgcctcgtcagacccgtcaatccgtccgaggaggagaagaaggaggtcttc
gccctcaaaatcctccgcaagaccgaggtcatcaagctcaagcaggtcgaccacgtgcgc
cacgagcggcacatcctcggcgacgtctccggccaccccttcatcaccaacatgattgcc
gccttctccgacgctgacacgctctacatgctgctcgactacgtccccggcggcgagctc
ttcagctacctgcgcaagatgcgccgcttcgacgagagcaccgccaagttctacacggcc
gagattgtgctcgtcctcgagtttctgcacgagcagcagggccgcgtcgcctatcgcgat
ctcaagcccgagaatctgctgctcgacaagaacggccacatcaagctcgtcgactttggc
ttcgccaagcgcctcagcagcgaagacggccagccaaccgagacgtacaccctctgcggc
acccccgagtacctcgcacccgaggtgatccataacaagggccacacgaccgccgtcgac
tggtgggcgctgggcattctgctgtacgagttcctcaccggctacccgccgttttggcac
cagaaccccatcgagatttacaagcagatcgtcgagaagcccgtcacgttcccggcggaa
ccgcacatttcggacaatgccaaggatctcatcaaatcgttctgcaccgtcgaccgctcc
aagcgcctcggcaacatgaacggtggcgcgcagcgcgtcaaagaccaccccttcttcaaa
ggcatccggtgggatgagctgctgggacagcgcgtgcgcggacccattgtgccgcccgtg
cgatcctcgagcgactcgcagtgcttcgatcagtatcccgaggaagatggcaagcgcgag
ccgtatacggacgaaatggcgcgccagtacgaccagtactttaaagatttttga

DBGET integrated database retrieval system