KEGG   Verticillium alfalfae: VDBG_02437Help
Entry
VDBG_02437        CDS       T02227                                 

Definition
(RefSeq) short chain enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
val  Verticillium alfalfae
Pathway
val00062  Fatty acid elongation
val00071  Fatty acid degradation
val00280  Valine, leucine and isoleucine degradation
val00310  Lysine degradation
val00380  Tryptophan metabolism
val00410  beta-Alanine metabolism
val00640  Propanoate metabolism
val00650  Butanoate metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
val01200  Carbon metabolism
val01212  Fatty acid metabolism
Module
val_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VDBG_02437
   00650 Butanoate metabolism
    VDBG_02437
  Lipid metabolism
   00062 Fatty acid elongation
    VDBG_02437
   00071 Fatty acid degradation
    VDBG_02437
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VDBG_02437
   00310 Lysine degradation
    VDBG_02437
   00380 Tryptophan metabolism
    VDBG_02437
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VDBG_02437
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VDBG_02437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Motif
Other DBs
NCBI-GeneID: 9533943
NCBI-ProteinID: XP_003008249
UniProt: C9SAG0
AA seq 230 aa AA seqDB search
MDSLKNIKVAVDSQKGVRCWLRSKFVGQDFETPASGMDLNELVQITTSSAHKRAFLKDLT
DAFAGFSKPVIAAVIGFALGGGCEIALACDIIYAAEDATFGLPEIKIGTIPGAGGTQRLA
RALGKHKAMEFVLTGDSASGAEFERLGVVNKAFPRDQVISAATSLAERIALMSGPVVQVA
KQAVLTVENSHLDAGMATEKMLYYSTFGLSDFKEGQTAFLQKRKPNFTHE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggacagtctcaagaacatcaaggtcgccgtcgacagccaaaagggcgtgcgctgttgg
ctccgttccaagttcgtgggccaagactttgagaccccggcatctggcatggatctcaac
gagctcgtgcagattactacctcatcggcccacaagagagctttcctcaaggatctcact
gacgcctttgctgggttctcaaagcccgtcatcgctgccgtcattgggtttgctcttggc
ggaggttgcgagatcgctctcgcgtgcgacattatctacgctgccgaagacgccaccttt
ggtcttcccgaaattaaaatcggtacaatccccggagccggcggaacacaacggctggcc
cgtgctctgggcaaacacaaggccatggagtttgtcctcaccggcgactctgcctccggg
gctgagtttgagcgactcggtgttgtcaacaaggcgttcccccgagatcaggtcatctct
gctgcgaccagcctcgcagagcgcatcgccttgatgtctgggcctgttgttcaggtcgcc
aagcaggccgttctgactgtggagaacagtcatctggacgcgggcatggcgacggagaag
atgctttactactccacgtttgggctgtcggacttcaaagaaggccaaacggctttcttg
cagaagagaaagcctaacttcacgcatgaatag

DBGET integrated database retrieval system