KEGG   Verticillium alfalfae: VDBG_02482Help
Entry
VDBG_02482        CDS       T02227                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
val  Verticillium alfalfae
Pathway
val00230  Purine metabolism
val01100  Metabolic pathways
Module
val_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_02482
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VDBG_02482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 DUF4539 AAA_16 ABC_tran AAA_18 AAA_22 NTPase_1 AAA_29 NACHT AAA_28 Viral_helicase1 AAA_24
Motif
Other DBs
NCBI-GeneID: 9533988
NCBI-ProteinID: XP_003008294
UniProt: C9SB13
AA seq 160 aa AA seqDB search
MPPGQTIVISGPSGVGKGTLIQKLQDTHRGLFTLTVSHTTRSPRPGEVDGVNYYFVSRAQ
FSALIAQNGFIEHTTFSGAMYGTSKRAIIDQAAKGLIQGTVVLLEIDQEGIKQLKQSPYI
PAALQGRVDYADTTPGLHDLVIVNDNIEKAYKELEEFIFR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgggtcagactatcgtcatctccggcccatcgggcgtgggaaaaggaaccctg
attcagaagctacaagacacgcaccgcggactctttacacttacagtttcacacaccaca
agaagccctcggccaggtgaggttgatggggtgaactactactttgtctcccgcgcacag
ttttctgctcttattgctcagaacggattcatagagcacacaacatttagcggtgctatg
tacggcactagcaagcgagctataatagaccaagcagccaaaggcttgattcaagggacc
gttgttctcctcgagattgaccaggaaggtatcaagcagctaaagcaaagtccctatatt
cccgccgctctccaaggcagagttgattacgcagatacaacacccgggctccatgacctc
gtcattgttaatgacaacattgaaaaggcatacaaagagctcgaggagttcatattccgg
taa

DBGET integrated database retrieval system