KEGG   Verticillium alfalfae: VDBG_02490Help
Entry
VDBG_02490        CDS       T02227                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
val  Verticillium alfalfae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VDBG_02490
Translation factors [BR:val03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    VDBG_02490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 728 aa AA seqDB search
MAPSYEHLREADLDEDEYDEEEIDISDLREKYEVQLEHGYDTFVVIDGLPAVTEEQKPKL
VKFLLKKLNQVGKTREDLIFMPMGEDGLSLRFAFVEYSSAGEAAAAVRGLDMVALDKKHI
LRVNKLTDIDRYGREGRVDEDYTPPQIEEFQEKEHLRWWLKDPSGRGRDQFVMYRGESVG
VCWNNEKEPAETVVDRQHWTESFVQWSPLGTYLTSVHAQGVQLWGGASWSRQRRFAHPFV
NLIAFSPNEKYIVTWSARPISIPEDGHPALSVDDDGKNYVIWDIETSKPLRSFASLDVPG
AEGDDGVAKQRKSPWPAFKWSADDKYVARLTQGSSISVYELPRMGLLDKTTIKIAGVMDF
DWAPATVHREGVKNYEQLFCYWTPEIGSNPAKVGLMSIPSKEIVRTLNLFSVSDVKLHWQ
SDASFLCVKVDRHSKSKKSQATSLEIFRVKEKGVPVEVVDTIKDTVVNFAWEPKGDRFVI
ITTTEARRPHGRRAQDIGRLLLPGEEQGNSIYWSPRGRFVVVATVHNTQSSDLDFYDLDF
EGEKPESDKDLTANLQLMNTADHYGVTDVEWDPSGRFVATWSSSWKHSMENGYHIYDFKG
EQLREEHVEKFKQFLWRPRPATLLTKEEQKQIRKNLREYSKTFEQEDADRGASADREVVE
ARRRQLDEWLAWRESIEEELVEERAYLGLPEDPIAELLASKVTNPDAEEQIIEEIVEEVI
EETEEILQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtcctacgagcaccttcgcgaggcagacctcgacgaagacgagtacgatgag
gaggagatcgatatttccgacctgcgcgagaagtacgaggtgcaactcgagcatggctac
gacacgtttgtcgtcattgatggccttcctgccgtcaccgaggagcagaagcccaagctg
gtcaagttcttgctgaagaaactgaaccaggtcggcaagacgcgagaggacctcatcttc
atgcccatgggtgaggatggcctgtctctaagattcgcctttgtcgaatactcttccgcc
ggcgaggccgccgctgccgtcaggggcctcgacatggttgccctcgacaagaagcacatc
ttgcgtgtcaacaagctgaccgacattgaccgttacggtcgcgagggccgcgttgacgag
gactacacccctcctcaaattgaggagttccaggagaaggagcacctccgatggtggctc
aaggaccccagtggccgtggccgcgaccagttcgtcatgtaccgcggagagtccgttggc
gtctgctggaacaacgagaaggagcccgccgagaccgtggtcgatcgtcagcactggacc
gagagcttcgtccagtggtcacccctcggcacatatttgacttcagttcacgcacaaggt
gttcagctctggggcggcgcttcctggtccaggcaaaggcggttcgcgcacccctttgtc
aacctcatcgctttctcccccaacgagaagtacatcgtcacttggtccgctcgccccatc
tccattcccgaggacggccacccggcgctctctgtggacgatgacggcaagaactacgtc
atttgggacattgagacgtccaagcccctccgatccttcgcgagccttgacgtccccggt
gctgagggcgatgatggcgtcgctaagcagcgcaagtccccctggcctgcgttcaagtgg
tcggccgatgacaagtacgtcgcccgtctgactcagggctcctctatttctgtttacgag
ctcccccgcatgggcctgctcgacaagacaacgatcaagattgccggtgtcatggacttt
gactgggcgcccgccaccgttcaccgcgagggcgtcaagaactacgagcagctcttctgc
tactggactcccgagattggcagcaaccccgccaaggtcggtctcatgagcattccctcc
aaggagatcgtgaggacattgaacctcttcagcgtcagcgatgtcaagcttcactggcag
tcggacgcctccttcctctgcgtcaaggtcgacaggcattccaagtcgaagaagtcacag
gccacgtcgctcgagattttccgcgtcaaggagaagggcgttcccgtcgaggtcgtcgac
acgatcaaggataccgtcgtcaactttgcctgggagcccaagggtgaccgcttcgtcatc
atcacgaccaccgaggcccgccggccccacggccgtcgcgcccaagacatcggtcgcctt
cttctgcccggagaagaacaaggcaactccatctactggtcaccccgcggccgcttcgtt
gttgtggctaccgttcacaacacgcagagctccgacctcgacttctacgacctcgacttt
gagggcgagaagcccgagtcagacaaggacctgactgccaaccttcagctcatgaacacg
gccgatcactacggcgtgactgacgttgagtgggacccctccggtcgcttcgtcgccacc
tggtcgtcctcgtggaagcacagcatggagaatggctaccatatttacgacttcaagggt
gagcagctacgcgaggagcatgtggagaagttcaagcagttcctctggcgcccgcgcccc
gcgacgctgctcaccaaggaggaacagaagcagatccgcaagaacctgcgcgagtacagc
aagacgttcgagcaggaggacgccgaccgtggcgcgtccgcggaccgcgaggtcgtcgag
gcccgccgccgccagctcgacgagtggctcgcgtggcgcgagtcgatcgaggaggagctt
gtcgaggagcgcgcctacctcggtctgcccgaggaccccatcgccgagctgcttgcttcc
aaggtcaccaaccccgacgccgaagagcagatcatcgaggagattgtggaggaggtcatc
gaggagacggaggagattctgcagtag

DBGET integrated database retrieval system