KEGG   Verticillium albo-atrum: VDBG_02490Help
Entry
VDBG_02490        CDS       T02227                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
val  Verticillium albo-atrum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:val03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 728 aa AA seqDB search
MAPSYEHLREADLDEDEYDEEEIDISDLREKYEVQLEHGYDTFVVIDGLPAVTEEQKPKL
VKFLLKKLNQVGKTREDLIFMPMGEDGLSLRFAFVEYSSAGEAAAAVRGLDMVALDKKHI
LRVNKLTDIDRYGREGRVDEDYTPPQIEEFQEKEHLRWWLKDPSGRGRDQFVMYRGESVG
VCWNNEKEPAETVVDRQHWTESFVQWSPLGTYLTSVHAQGVQLWGGASWSRQRRFAHPFV
NLIAFSPNEKYIVTWSARPISIPEDGHPALSVDDDGKNYVIWDIETSKPLRSFASLDVPG
AEGDDGVAKQRKSPWPAFKWSADDKYVARLTQGSSISVYELPRMGLLDKTTIKIAGVMDF
DWAPATVHREGVKNYEQLFCYWTPEIGSNPAKVGLMSIPSKEIVRTLNLFSVSDVKLHWQ
SDASFLCVKVDRHSKSKKSQATSLEIFRVKEKGVPVEVVDTIKDTVVNFAWEPKGDRFVI
ITTTEARRPHGRRAQDIGRLLLPGEEQGNSIYWSPRGRFVVVATVHNTQSSDLDFYDLDF
EGEKPESDKDLTANLQLMNTADHYGVTDVEWDPSGRFVATWSSSWKHSMENGYHIYDFKG
EQLREEHVEKFKQFLWRPRPATLLTKEEQKQIRKNLREYSKTFEQEDADRGASADREVVE
ARRRQLDEWLAWRESIEEELVEERAYLGLPEDPIAELLASKVTNPDAEEQIIEEIVEEVI
EETEEILQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtcctacgagcaccttcgcgaggcagacctcgacgaagacgagtacgatgag
gaggagatcgatatttccgacctgcgcgagaagtacgaggtgcaactcgagcatggctac
gacacgtttgtcgtcattgatggccttcctgccgtcaccgaggagcagaagcccaagctg
gtcaagttcttgctgaagaaactgaaccaggtcggcaagacgcgagaggacctcatcttc
atgcccatgggtgaggatggcctgtctctaagattcgcctttgtcgaatactcttccgcc
ggcgaggccgccgctgccgtcaggggcctcgacatggttgccctcgacaagaagcacatc
ttgcgtgtcaacaagctgaccgacattgaccgttacggtcgcgagggccgcgttgacgag
gactacacccctcctcaaattgaggagttccaggagaaggagcacctccgatggtggctc
aaggaccccagtggccgtggccgcgaccagttcgtcatgtaccgcggagagtccgttggc
gtctgctggaacaacgagaaggagcccgccgagaccgtggtcgatcgtcagcactggacc
gagagcttcgtccagtggtcacccctcggcacatatttgacttcagttcacgcacaaggt
gttcagctctggggcggcgcttcctggtccaggcaaaggcggttcgcgcacccctttgtc
aacctcatcgctttctcccccaacgagaagtacatcgtcacttggtccgctcgccccatc
tccattcccgaggacggccacccggcgctctctgtggacgatgacggcaagaactacgtc
atttgggacattgagacgtccaagcccctccgatccttcgcgagccttgacgtccccggt
gctgagggcgatgatggcgtcgctaagcagcgcaagtccccctggcctgcgttcaagtgg
tcggccgatgacaagtacgtcgcccgtctgactcagggctcctctatttctgtttacgag
ctcccccgcatgggcctgctcgacaagacaacgatcaagattgccggtgtcatggacttt
gactgggcgcccgccaccgttcaccgcgagggcgtcaagaactacgagcagctcttctgc
tactggactcccgagattggcagcaaccccgccaaggtcggtctcatgagcattccctcc
aaggagatcgtgaggacattgaacctcttcagcgtcagcgatgtcaagcttcactggcag
tcggacgcctccttcctctgcgtcaaggtcgacaggcattccaagtcgaagaagtcacag
gccacgtcgctcgagattttccgcgtcaaggagaagggcgttcccgtcgaggtcgtcgac
acgatcaaggataccgtcgtcaactttgcctgggagcccaagggtgaccgcttcgtcatc
atcacgaccaccgaggcccgccggccccacggccgtcgcgcccaagacatcggtcgcctt
cttctgcccggagaagaacaaggcaactccatctactggtcaccccgcggccgcttcgtt
gttgtggctaccgttcacaacacgcagagctccgacctcgacttctacgacctcgacttt
gagggcgagaagcccgagtcagacaaggacctgactgccaaccttcagctcatgaacacg
gccgatcactacggcgtgactgacgttgagtgggacccctccggtcgcttcgtcgccacc
tggtcgtcctcgtggaagcacagcatggagaatggctaccatatttacgacttcaagggt
gagcagctacgcgaggagcatgtggagaagttcaagcagttcctctggcgcccgcgcccc
gcgacgctgctcaccaaggaggaacagaagcagatccgcaagaacctgcgcgagtacagc
aagacgttcgagcaggaggacgccgaccgtggcgcgtccgcggaccgcgaggtcgtcgag
gcccgccgccgccagctcgacgagtggctcgcgtggcgcgagtcgatcgaggaggagctt
gtcgaggagcgcgcctacctcggtctgcccgaggaccccatcgccgagctgcttgcttcc
aaggtcaccaaccccgacgccgaagagcagatcatcgaggagattgtggaggaggtcatc
gaggagacggaggagattctgcagtag

DBGET integrated database retrieval system