KEGG   Verticillium alfalfae: VDBG_02628Help
Entry
VDBG_02628        CDS       T02227                                 

Definition
MAP kinase kinase MKK1/SSP32
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
val  Verticillium alfalfae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:val00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    VDBG_02628
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     VDBG_02628
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   VDBG_02628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 513 aa AA seqDB search
MADQNPSQPTNMDPTPYQIPSLSPANSQGNVPTMSSPVPLLRPAIPGARSSGARAPRLGL
AIPPSPNAKPVGNQPAPPAPRALPTLHLATPMGSQGLPYEQPPRLNTSVQGHSASGGSES
SAAHSRSGSFGPLDGRASNPTSAGSQYSALSFASQYGIGGSRPQGTPDPVSAVGSLYSER
SEGGVGMERDNSLQGLEQFDKLSLEKARSLDVEDLDDDGWRIASLESRIEELGNLGEGAG
GAVTRAKLKGGKTVFALKKQIVRELNFNKGCASEHICRYYGAFVDPATATISIAMEYCEG
GSLDSIYKEVKKLGGRTGEKVLGKISEGVLRGLTYLHGRRIIHRDIKPSNILLCRNGEVK
LCDFGVSGDFGTKGEANTFIGTSYYMAPERITGQSYTITSDVWSTGVTLLEVAQHRFPFP
ADGTEMQPRAGLIDLLTYIVRQPIPKLKDETDVTWSDNFKYFIECCLEKDPTRRASPWRM
LDHPWMVEMRSKRVNMEKYLSQVWGWDNPKAEA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagaacccatcccaacccaccaacatggatcctacaccataccagatcccc
agtctgtccccggcaaactcccaaggcaacgttccgaccatgtcctccccagtccctctt
ctacgccctgcgatacctggcgcccgatcgagtggtgcccgagcaccaagattggggctc
gccatcccgccgtcccccaatgcgaagcctgtgggcaaccagcccgccccgccggctcct
cgtgcgttgcccaccctacaccttgccactccgatgggcagccaaggcttgccttacgag
cagcctcctcgactgaacacgagtgttcagggccactctgccagcggaggcagcgagagc
agcgcggcccactcgagatcgggcagctttggacccctggatggacgtgccagtaacccc
acctcggccggttcgcaatactcggctctttcctttgcctcccagtatggtattgggggg
tcaagaccccagggcacccctgacccggtatccgccgtcgggtctctctactcggaacgt
agcgagggtggtgttggtatggagagagacaacagcctccaaggcttggaacagtttgat
aagcttagtttggagaaggcgaggtctctggacgtggaagacctcgacgatgatggctgg
aggattgccagtctcgagtctaggatcgaagagctcggcaacctcggcgaaggtgctggc
ggtgccgtgacaagagccaagctcaagggcggcaagactgtctttgccctgaagaaacaa
atcgttcgagagctcaacttcaacaagggctgtgcatcagagcacatttgccggtactac
ggcgccttcgtcgaccctgccactgccaccatttctatcgccatggagtactgcgagggt
ggctcgctcgacagcatctacaaagaggtcaagaaactcggtggccgcaccggcgagaag
gtcctcggcaaaatctcagagggcgttctgcgtggcttgacgtatctccacggacgacgc
atcattcaccgtgacatcaagccgtctaacatcttactctgccgcaacggcgaggtcaaa
ctgtgcgactttggcgtctcgggcgactttggaaccaagggcgaggccaacacgttcatc
ggtaccagctattacatggcgcccgagcgaatcacgggacaaagctacaccattacctct
gacgtgtggtccactggcgttacactgcttgaggttgcgcagcatcggttcccattccca
gccgacgggaccgagatgcagcctagggcaggactcattgacctgttgacctatatcgtg
cggcagccgatacccaaactcaaggacgagactgatgtcacttggagtgacaacttcaag
tactttatcgagtgctgtctcgagaaggacccaacccgccgtgcaagcccatggcggatg
ctcgaccacccctggatggtcgagatgcgttcaaagcgtgtcaacatggagaaatacctg
tcacaagtatggggttgggacaacccaaaggcggaagcgtaa

DBGET integrated database retrieval system