KEGG   Verticillium albo-atrum: VDBG_02755Help
Entry
VDBG_02755        CDS       T02227                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
val  Verticillium albo-atrum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:val01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:val00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:val00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:val00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:val00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1763 aa AA seqDB search
MKLAGTARHWEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKDATFKAMEDAA
VRLGRLVGYVSAGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQVAMG
IPLHRIRDIRLLYGVDPKTSTEIDFEFKDPGSEKTQRRPRPKGHTTACRITSEDPGEGFK
PSNGVMHDLNFRSSSNVWGYFSVSSASSIHSFSDSQFGHIFAYGENRSASRKHMVIALKE
LSIRGDFRTTVEYLIKLLETEAFEDNTITTGWLDELITKKLTAERPDPMLAVVCGAVTKA
HIASEDCISEYRKSLDKGQVPSKDILKTVFAVDFIYEGFRYKFTATRASVDAYHVFINGS
KCAVGVRVLSDGGLLILLSGRSHSVYWKEEVGATRLSVDGKTCLLEQENDPTQLRTPSPG
KLVKYLVENGSHVKAGQSFAEVEVMKMYMPLIASEDGVVQLIKQPGATLEAGDILGILAL
DDPSRVKQAQPFLGQLPSYGDPVAVGNKPAQRFSVLYNILKNILLGYDNSVIMAATLKEL
VEVLRNPELPYSEWNAQFAALHSRMPQKLDAQFGQIVERAKSRHVEFPAKALVKAFQKFL
DENVAAGDVDLLKSTLAPLSEVLSAYSEGQKAHELNVVKSLLEQYAETEQLFTGQGSQED
STILKLRDQNKDDISKVVQTVLSHSRVSAKSSLILAILEEYRPNKPNVGNIGKHLRDALR
TLTELQSSRATSKVSLKAREIMIQCSLPSLEERTSQMEHILKSSVVESRYGEAAWEHREP
NLDVIKEVVDSKYTVFDVLTLFFSHEDPFVSIAALEVYVRRAYRAYIIKKIEYHEDETEA
PLFVSWDFTIRKMGQSEYGLPLQSAAPSTPATPSGQFDFKRISSISDLSYFNSKMDEEPN
RKGVIVPCKYLEDAEDLIARALEALGEKRKAAPAPSLLPDLTGKRKIVGASKPHEQELSA
VINVAVRDAESKNDQEILARIKPIIAQLKGDLLARRVRRISFICGRNDGSYPGYYTFRGP
GYEEDDSIRHSEPALAFQLELGRLAKFNIKPVFTENKNIHVYEGIGKAVETDKRYFTRAV
IRPGRLRDEIPTTEYLISEADRVVNDIFDALEIIGNNNSDLNHIFINFTPVFQLEPSEVE
SSLQGFLDRFGPRAWRLRVSQVEIRIICTDPQSGVPYPLRVIINNTSGYVVDVDIYSERK
SDKGEWVFHSIGGTHEKGPMHLLAVTTPYATKNWLQPKRYKAHLMGTQYVYDFPELFRQA
IQNSWVTSVKKNGALASQQPKAGDCVSFTELVLDDKNNLDEVSREPGTNACGMVGWIFNA
KTPEYPKGRKFIVVANDITYRIGSFGPKEDNFFNKCTELARKLGIPRIYLSANSGARLGV
ADELIPHFKVAWNDPAKQDGGFKYLYLDDESKKEFEQAVITEEVTEEGEKRHKIVTIIGT
ADGLGVESLRGSGLIAGATSRAYNDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIIL
TGAPALNNVLGREIYTSNLQLGGTQIMYRNGVSHMTANDDFAGVSKIVEWMSFVPKERGS
PIPISPSIDTWDRDVVYTPQQKGAFDVRWMIGGRQTDDGDFEAGLFDKDSFIETLGGWAR
TVVVGRARLGGIPMGVIAVESRSIENITPADPANPDSIEQVTNEAGGVWYPNSAFKTAQA
INDFNNGEQLPLMILANWGWFLWGASAKMYNEGPPRMVRSSSNALVKVLSRPHLPCTSPP
FRELRWGFFGAGVGPRPIQPYCH
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgccggcaccgcgcggcattgggaggtgcagctgctggcggatcagtacggc
aacaacatctcgctgttcggcagagattgttccgtgcagcgtcgtcaccagaagattatc
gaggaggcccccgtcaccattgccaaggacgcgacgttcaaggccatggaggacgctgct
gtgcgtctcggcaggctcgtcggttacgtgtctgctggtaccgtcgagtacctctactca
cactcggacgacaagttctacttcctggaactgaacccgcgtcttcaggttgagcatccc
accaccgagatggtcagcggtgtcaacctgcccgccgcccagctgcaggtcgccatgggc
attcccctgcacaggatccgcgacattcgtctgctgtacggcgtcgaccccaagacgtcg
actgaaatcgactttgagttcaaggaccccggaagcgagaagacccagaggaggccccgt
cccaagggccacaccacggcctgccgtatcacctcggaggaccccggtgagggcttcaag
ccttccaacggtgtgatgcacgacctgaacttcaggagtagctccaatgtttggggctac
ttctccgtcagctctgcctccagtatccacagcttctccgattcacagttcggtcacatc
ttcgcgtacggcgagaaccgctccgcgtccaggaaacacatggtcattgccttgaaggag
ctcagcattcgtggtgacttcaggacaaccgtcgagtaccttatcaagctgctcgagacg
gaggcctttgaggacaacaccatcaccaccggctggctcgacgagctcatcaccaagaag
ttgactgctgagcgccctgaccccatgctggctgtcgtctgtggtgctgtcaccaaggcg
cacattgccagtgaagactgcatctcggagtaccgcaagagtctggacaagggtcaagtg
ccctccaaggacatcctgaagacggtcttcgctgtggactttatctacgagggcttccgc
tacaagttcaccgccacgcgtgccagtgtcgacgcctaccacgttttcatcaacgggtcc
aagtgcgccgtcggtgtccgcgttctcagtgacggtggcctcctgatcctgctcagcgga
cgcagccacagcgtctactggaaggaggaagttggcgctacgcgactgtccgttgacggc
aagacgtgcctgcttgagcaggagaacgaccccacgcagctccgcacgcccagccctggt
aagcttgtgaagtacctcgtcgagaacggttcgcacgtcaaggccggccaaagcttcgcc
gaggttgaggtgatgaagatgtatatgcctctcatcgcctccgaagacggcgttgttcag
ctcatcaagcagcccggagctacgcttgaggctggtgacattctcggcatactcgccctc
gacgaccccagcagggtcaagcaggcgcagcctttcctcggccagctgcccagctacggt
gaccccgtcgctgtcggtaacaagcccgcccagcggttctcggtcctctacaacattctg
aagaacatcctcctcggctacgacaactcggtcatcatggcagccacgctgaaggaactc
gttgaggtccttcgcaaccctgagctgccctacagcgagtggaacgcccagtttgccgct
ctgcactctcgcatgcctcagaagctggatgcgcagttcggtcagattgtcgagcgcgcc
aagtcgcgccacgtcgagttcccggccaaggcgctggtcaaggctttccagaagttcctc
gacgagaacgtcgctgccggcgacgtcgatctgctcaagtccactctggcgccgctcagc
gaggtgctcagcgcctacagcgagggtcagaaggcgcatgagctgaatgtcgtcaagagc
ctgctcgagcagtacgccgagactgagcagctcttcactggacagggttctcaggaggac
agcaccattctcaagctccgtgaccagaacaaggatgacatctccaaggttgtccagacc
gtcctgtcgcacagccgtgtcagcgccaagagctcgctcattctcgccatccttgaggag
taccgccccaacaagcccaacgtcggcaacattggcaagcatctccgcgatgccctgcgt
accctgactgagctccagtcctcgcgtgccacctccaaggtgtccctcaaggctcgcgag
attatgatccagtgctctcttccttctctggaggagcgcacctcgcagatggagcacatt
ctcaagtcttctgttgtcgagtctcgctatggcgaggctgcttgggagcaccgtgagccc
aaccttgacgtcatcaaggaggtcgttgattccaagtacaccgtctttgacgttctcacc
ctcttcttctcgcacgaggaccccttcgtgtcgattgccgccctcgaggtctacgtccgc
cgcgcctacagggcctacatcatcaagaagatcgagtaccatgaggatgagacggaggcg
cctctctttgtgtcctgggacttcacgatcaggaagatgggccagagcgagtacggcctt
cccttgcagtccgctgccccctccacccctgccacccccagcggtcagtttgacttcaag
cgcatctcttccatcagcgacctttcgtacttcaactccaagatggacgaggagcccaac
cgcaagggtgtcattgtgccctgcaagtacctcgaggacgccgaggacctgatcgctcgc
gctctcgaggcgctcggcgagaagaggaaggccgcccccgcgcccagcctgctgcctgac
ctgaccggcaagcgcaagattgtgggcgccagcaagccccacgagcaggagctctctgcc
gttatcaacgtcgctgttcgtgatgccgagagcaagaatgaccaggagatccttgcccgc
atcaagcccatcatcgctcagctcaagggtgacctccttgcccgccgtgtccgtcgcatc
agtttcatctgcggccgcaacgacggctcgtaccccggttactacaccttccggggtccc
ggctacgaggaggacgacagcattcgtcacagcgagcctgctcttgctttccagctggag
ctgggacgtctcgccaagttcaacatcaagcccgtcttcactgagaacaagaacatccac
gtttacgagggcattggcaaggccgtcgagaccgataagcgttacttcactcgcgctgtc
attcgtccgggtcgtctccgtgatgagattcccaccaccgaatacctcatctccgaggct
gaccgtgtcgtcaacgacatctttgacgctctcgagatcatcggcaacaacaactctgat
ctgaaccacatcttcatcaacttcacgcccgtcttccagctcgagccttcggaggttgag
agcagcctccagggcttcctcgaccgcttcggtcctcgcgcgtggcgtcttcgtgtctcc
caggtcgagattcgcatcatctgtaccgatcctcagagcggtgtgccctaccctcttcgc
gtcatcatcaacaacacctccggatatgttgtcgatgtcgatatctactcggagcgcaag
tccgacaagggcgagtgggtattccacagcattggcggcacccacgagaagggccccatg
cacctgctcgctgtcaccacaccatacgcgaccaagaactggctgcagcccaagcgttac
aaggcccacctcatgggaactcagtacgtctacgatttccccgagctcttccgccaggcc
atccagaacagctgggtcacgagcgtcaagaagaacggcgctcttgcttcgcagcagcct
aaggccggtgattgcgtctcattcaccgagctcgttctcgacgacaagaacaacctggac
gaggtcagccgtgagcccggcaccaatgcgtgcggcatggtcggctggatcttcaacgcc
aagacccccgagtatcccaagggtcgcaagttcatcgtcgtcgccaacgacatcacgtac
cgcatcggctccttcggccccaaggaagacaacttcttcaacaagtgcacggagctggcg
cgcaagcttggcattccccgcatctacttgtctgccaactcgggtgcccgtctcggcgtt
gccgacgagctgatcccccacttcaaggttgcgtggaacgaccctgctaagcaggacggc
ggcttcaagtacctgtacctcgacgacgagagcaagaaggagttcgagcaggctgtcatc
accgaggaggttacggaggagggcgagaagcgccacaagatcgtcaccatcatcggtacg
gccgacggtctcggtgttgagtcgctgcgtggctctggtctcatcgccggtgccaccagc
cgtgcttacaacgacattttcaccgtgaccctggtgacgtgccgttccgtcggtatcggt
gcttacctcgtccgtctcggtcagcgtgccgtccagattgagggccagcccatcatcctg
accggtgcccctgccctgaacaacgtcctgggtcgtgagatctacacatccaacctccag
cttggtggcacccagatcatgtaccgcaacggtgtctcgcacatgactgccaacgacgat
ttcgccggtgtttccaagattgttgagtggatgtcgtttgtgcccaaggagcgcggcagc
cccatccccatcagccccagcattgacacctgggaccgtgacgtcgtctacacgccccag
cagaagggtgcgttcgacgttcgctggatgattggcggccgacagacagacgacggcgac
ttcgaggccggcctgtttgacaaggactcgttcatcgagaccctcggcggctgggcgcgt
accgtcgttgtcggtcgcgctcgtctcggtggcatccccatgggtgtcattgccgtcgag
tctcgttcgatcgagaacattacgccggccgaccctgccaaccccgactcgatcgagcag
gtcaccaacgaagctggcggtgtctggtaccccaactcggcgttcaagactgctcaggcc
attaacgacttcaacaacggtgagcagctgccgctgatgatcctcgccaactgggggtgg
tttctctggggggccagcgcgaaaatgtacaacgaaggccctccaagaatggttcgttca
tcgtcgaacgctctcgtcaaagtattaagcaggccccatcttccgtgtacatccccgccc
tttcgcgagctgcggtgggggttctttggggccggtgtcggaccccgacccattcaaccc
tactgtcattga

DBGET integrated database retrieval system