KEGG   Verticillium alfalfae: VDBG_02755Help
Entry
VDBG_02755        CDS       T02227                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
val  Verticillium alfalfae
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VDBG_02755
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VDBG_02755
   00640 Propanoate metabolism
    VDBG_02755
  Lipid metabolism
   00061 Fatty acid biosynthesis
    VDBG_02755
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    VDBG_02755
Enzymes [BR:val01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     VDBG_02755
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     VDBG_02755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1763 aa AA seqDB search
MKLAGTARHWEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKDATFKAMEDAA
VRLGRLVGYVSAGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQVAMG
IPLHRIRDIRLLYGVDPKTSTEIDFEFKDPGSEKTQRRPRPKGHTTACRITSEDPGEGFK
PSNGVMHDLNFRSSSNVWGYFSVSSASSIHSFSDSQFGHIFAYGENRSASRKHMVIALKE
LSIRGDFRTTVEYLIKLLETEAFEDNTITTGWLDELITKKLTAERPDPMLAVVCGAVTKA
HIASEDCISEYRKSLDKGQVPSKDILKTVFAVDFIYEGFRYKFTATRASVDAYHVFINGS
KCAVGVRVLSDGGLLILLSGRSHSVYWKEEVGATRLSVDGKTCLLEQENDPTQLRTPSPG
KLVKYLVENGSHVKAGQSFAEVEVMKMYMPLIASEDGVVQLIKQPGATLEAGDILGILAL
DDPSRVKQAQPFLGQLPSYGDPVAVGNKPAQRFSVLYNILKNILLGYDNSVIMAATLKEL
VEVLRNPELPYSEWNAQFAALHSRMPQKLDAQFGQIVERAKSRHVEFPAKALVKAFQKFL
DENVAAGDVDLLKSTLAPLSEVLSAYSEGQKAHELNVVKSLLEQYAETEQLFTGQGSQED
STILKLRDQNKDDISKVVQTVLSHSRVSAKSSLILAILEEYRPNKPNVGNIGKHLRDALR
TLTELQSSRATSKVSLKAREIMIQCSLPSLEERTSQMEHILKSSVVESRYGEAAWEHREP
NLDVIKEVVDSKYTVFDVLTLFFSHEDPFVSIAALEVYVRRAYRAYIIKKIEYHEDETEA
PLFVSWDFTIRKMGQSEYGLPLQSAAPSTPATPSGQFDFKRISSISDLSYFNSKMDEEPN
RKGVIVPCKYLEDAEDLIARALEALGEKRKAAPAPSLLPDLTGKRKIVGASKPHEQELSA
VINVAVRDAESKNDQEILARIKPIIAQLKGDLLARRVRRISFICGRNDGSYPGYYTFRGP
GYEEDDSIRHSEPALAFQLELGRLAKFNIKPVFTENKNIHVYEGIGKAVETDKRYFTRAV
IRPGRLRDEIPTTEYLISEADRVVNDIFDALEIIGNNNSDLNHIFINFTPVFQLEPSEVE
SSLQGFLDRFGPRAWRLRVSQVEIRIICTDPQSGVPYPLRVIINNTSGYVVDVDIYSERK
SDKGEWVFHSIGGTHEKGPMHLLAVTTPYATKNWLQPKRYKAHLMGTQYVYDFPELFRQA
IQNSWVTSVKKNGALASQQPKAGDCVSFTELVLDDKNNLDEVSREPGTNACGMVGWIFNA
KTPEYPKGRKFIVVANDITYRIGSFGPKEDNFFNKCTELARKLGIPRIYLSANSGARLGV
ADELIPHFKVAWNDPAKQDGGFKYLYLDDESKKEFEQAVITEEVTEEGEKRHKIVTIIGT
ADGLGVESLRGSGLIAGATSRAYNDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPIIL
TGAPALNNVLGREIYTSNLQLGGTQIMYRNGVSHMTANDDFAGVSKIVEWMSFVPKERGS
PIPISPSIDTWDRDVVYTPQQKGAFDVRWMIGGRQTDDGDFEAGLFDKDSFIETLGGWAR
TVVVGRARLGGIPMGVIAVESRSIENITPADPANPDSIEQVTNEAGGVWYPNSAFKTAQA
INDFNNGEQLPLMILANWGWFLWGASAKMYNEGPPRMVRSSSNALVKVLSRPHLPCTSPP
FRELRWGFFGAGVGPRPIQPYCH
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgccggcaccgcgcggcattgggaggtgcagctgctggcggatcagtacggc
aacaacatctcgctgttcggcagagattgttccgtgcagcgtcgtcaccagaagattatc
gaggaggcccccgtcaccattgccaaggacgcgacgttcaaggccatggaggacgctgct
gtgcgtctcggcaggctcgtcggttacgtgtctgctggtaccgtcgagtacctctactca
cactcggacgacaagttctacttcctggaactgaacccgcgtcttcaggttgagcatccc
accaccgagatggtcagcggtgtcaacctgcccgccgcccagctgcaggtcgccatgggc
attcccctgcacaggatccgcgacattcgtctgctgtacggcgtcgaccccaagacgtcg
actgaaatcgactttgagttcaaggaccccggaagcgagaagacccagaggaggccccgt
cccaagggccacaccacggcctgccgtatcacctcggaggaccccggtgagggcttcaag
ccttccaacggtgtgatgcacgacctgaacttcaggagtagctccaatgtttggggctac
ttctccgtcagctctgcctccagtatccacagcttctccgattcacagttcggtcacatc
ttcgcgtacggcgagaaccgctccgcgtccaggaaacacatggtcattgccttgaaggag
ctcagcattcgtggtgacttcaggacaaccgtcgagtaccttatcaagctgctcgagacg
gaggcctttgaggacaacaccatcaccaccggctggctcgacgagctcatcaccaagaag
ttgactgctgagcgccctgaccccatgctggctgtcgtctgtggtgctgtcaccaaggcg
cacattgccagtgaagactgcatctcggagtaccgcaagagtctggacaagggtcaagtg
ccctccaaggacatcctgaagacggtcttcgctgtggactttatctacgagggcttccgc
tacaagttcaccgccacgcgtgccagtgtcgacgcctaccacgttttcatcaacgggtcc
aagtgcgccgtcggtgtccgcgttctcagtgacggtggcctcctgatcctgctcagcgga
cgcagccacagcgtctactggaaggaggaagttggcgctacgcgactgtccgttgacggc
aagacgtgcctgcttgagcaggagaacgaccccacgcagctccgcacgcccagccctggt
aagcttgtgaagtacctcgtcgagaacggttcgcacgtcaaggccggccaaagcttcgcc
gaggttgaggtgatgaagatgtatatgcctctcatcgcctccgaagacggcgttgttcag
ctcatcaagcagcccggagctacgcttgaggctggtgacattctcggcatactcgccctc
gacgaccccagcagggtcaagcaggcgcagcctttcctcggccagctgcccagctacggt
gaccccgtcgctgtcggtaacaagcccgcccagcggttctcggtcctctacaacattctg
aagaacatcctcctcggctacgacaactcggtcatcatggcagccacgctgaaggaactc
gttgaggtccttcgcaaccctgagctgccctacagcgagtggaacgcccagtttgccgct
ctgcactctcgcatgcctcagaagctggatgcgcagttcggtcagattgtcgagcgcgcc
aagtcgcgccacgtcgagttcccggccaaggcgctggtcaaggctttccagaagttcctc
gacgagaacgtcgctgccggcgacgtcgatctgctcaagtccactctggcgccgctcagc
gaggtgctcagcgcctacagcgagggtcagaaggcgcatgagctgaatgtcgtcaagagc
ctgctcgagcagtacgccgagactgagcagctcttcactggacagggttctcaggaggac
agcaccattctcaagctccgtgaccagaacaaggatgacatctccaaggttgtccagacc
gtcctgtcgcacagccgtgtcagcgccaagagctcgctcattctcgccatccttgaggag
taccgccccaacaagcccaacgtcggcaacattggcaagcatctccgcgatgccctgcgt
accctgactgagctccagtcctcgcgtgccacctccaaggtgtccctcaaggctcgcgag
attatgatccagtgctctcttccttctctggaggagcgcacctcgcagatggagcacatt
ctcaagtcttctgttgtcgagtctcgctatggcgaggctgcttgggagcaccgtgagccc
aaccttgacgtcatcaaggaggtcgttgattccaagtacaccgtctttgacgttctcacc
ctcttcttctcgcacgaggaccccttcgtgtcgattgccgccctcgaggtctacgtccgc
cgcgcctacagggcctacatcatcaagaagatcgagtaccatgaggatgagacggaggcg
cctctctttgtgtcctgggacttcacgatcaggaagatgggccagagcgagtacggcctt
cccttgcagtccgctgccccctccacccctgccacccccagcggtcagtttgacttcaag
cgcatctcttccatcagcgacctttcgtacttcaactccaagatggacgaggagcccaac
cgcaagggtgtcattgtgccctgcaagtacctcgaggacgccgaggacctgatcgctcgc
gctctcgaggcgctcggcgagaagaggaaggccgcccccgcgcccagcctgctgcctgac
ctgaccggcaagcgcaagattgtgggcgccagcaagccccacgagcaggagctctctgcc
gttatcaacgtcgctgttcgtgatgccgagagcaagaatgaccaggagatccttgcccgc
atcaagcccatcatcgctcagctcaagggtgacctccttgcccgccgtgtccgtcgcatc
agtttcatctgcggccgcaacgacggctcgtaccccggttactacaccttccggggtccc
ggctacgaggaggacgacagcattcgtcacagcgagcctgctcttgctttccagctggag
ctgggacgtctcgccaagttcaacatcaagcccgtcttcactgagaacaagaacatccac
gtttacgagggcattggcaaggccgtcgagaccgataagcgttacttcactcgcgctgtc
attcgtccgggtcgtctccgtgatgagattcccaccaccgaatacctcatctccgaggct
gaccgtgtcgtcaacgacatctttgacgctctcgagatcatcggcaacaacaactctgat
ctgaaccacatcttcatcaacttcacgcccgtcttccagctcgagccttcggaggttgag
agcagcctccagggcttcctcgaccgcttcggtcctcgcgcgtggcgtcttcgtgtctcc
caggtcgagattcgcatcatctgtaccgatcctcagagcggtgtgccctaccctcttcgc
gtcatcatcaacaacacctccggatatgttgtcgatgtcgatatctactcggagcgcaag
tccgacaagggcgagtgggtattccacagcattggcggcacccacgagaagggccccatg
cacctgctcgctgtcaccacaccatacgcgaccaagaactggctgcagcccaagcgttac
aaggcccacctcatgggaactcagtacgtctacgatttccccgagctcttccgccaggcc
atccagaacagctgggtcacgagcgtcaagaagaacggcgctcttgcttcgcagcagcct
aaggccggtgattgcgtctcattcaccgagctcgttctcgacgacaagaacaacctggac
gaggtcagccgtgagcccggcaccaatgcgtgcggcatggtcggctggatcttcaacgcc
aagacccccgagtatcccaagggtcgcaagttcatcgtcgtcgccaacgacatcacgtac
cgcatcggctccttcggccccaaggaagacaacttcttcaacaagtgcacggagctggcg
cgcaagcttggcattccccgcatctacttgtctgccaactcgggtgcccgtctcggcgtt
gccgacgagctgatcccccacttcaaggttgcgtggaacgaccctgctaagcaggacggc
ggcttcaagtacctgtacctcgacgacgagagcaagaaggagttcgagcaggctgtcatc
accgaggaggttacggaggagggcgagaagcgccacaagatcgtcaccatcatcggtacg
gccgacggtctcggtgttgagtcgctgcgtggctctggtctcatcgccggtgccaccagc
cgtgcttacaacgacattttcaccgtgaccctggtgacgtgccgttccgtcggtatcggt
gcttacctcgtccgtctcggtcagcgtgccgtccagattgagggccagcccatcatcctg
accggtgcccctgccctgaacaacgtcctgggtcgtgagatctacacatccaacctccag
cttggtggcacccagatcatgtaccgcaacggtgtctcgcacatgactgccaacgacgat
ttcgccggtgtttccaagattgttgagtggatgtcgtttgtgcccaaggagcgcggcagc
cccatccccatcagccccagcattgacacctgggaccgtgacgtcgtctacacgccccag
cagaagggtgcgttcgacgttcgctggatgattggcggccgacagacagacgacggcgac
ttcgaggccggcctgtttgacaaggactcgttcatcgagaccctcggcggctgggcgcgt
accgtcgttgtcggtcgcgctcgtctcggtggcatccccatgggtgtcattgccgtcgag
tctcgttcgatcgagaacattacgccggccgaccctgccaaccccgactcgatcgagcag
gtcaccaacgaagctggcggtgtctggtaccccaactcggcgttcaagactgctcaggcc
attaacgacttcaacaacggtgagcagctgccgctgatgatcctcgccaactgggggtgg
tttctctggggggccagcgcgaaaatgtacaacgaaggccctccaagaatggttcgttca
tcgtcgaacgctctcgtcaaagtattaagcaggccccatcttccgtgtacatccccgccc
tttcgcgagctgcggtgggggttctttggggccggtgtcggaccccgacccattcaaccc
tactgtcattga

DBGET integrated database retrieval system