KEGG   Verticillium alfalfae: VDBG_03060Help
Entry
VDBG_03060        CDS       T02227                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
val  Verticillium alfalfae
Pathway
val00010  Glycolysis / Gluconeogenesis
val00071  Fatty acid degradation
val00350  Tyrosine metabolism
val01100  Metabolic pathways
val01110  Biosynthesis of secondary metabolites
val01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDBG_03060
  Lipid metabolism
   00071 Fatty acid degradation
    VDBG_03060
  Amino acid metabolism
   00350 Tyrosine metabolism
    VDBG_03060
Enzymes [BR:val01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VDBG_03060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 adh_short ADH_N_2
Motif
Other DBs
NCBI-GeneID: 9533071
NCBI-ProteinID: XP_003006921
UniProt: C9SCY6
AA seq 357 aa AA seqDB search
MGEWQQQRNRAVVYLEPGTTKTAVVELPIAEPGPGEVLVKLHYSGVCHTDAAFCLNSFST
VPPTAQGQIGGHEGAGEVVALGPGVTAPAVGSFVGIKFAADACLTCDNCIEGGDSTCQQT
QISGYTVPGTFQRFCTTPARYATPIPSGLDLASAAPLMCGGISVYTALRTAGLRVGDWVV
ISGAGGGLGHLGVQYAKALGARVVAVDAGVKEALCRELGADDFVDFAAFASDADLAARIK
EATGGGARIALMCSASSKSYGQCMSWLGFRGTVACLGIPDKEGALLPSIGDMVTFEHRII
ATKTGNRLEAKQCLELAAQGRVKTRYTLRRMESLTNIFEELESGKIQGRVVLDLRGD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagtggcagcagcagcgcaatcgtgccgtcgtgtacctggaacccggcaccacc
aagacggcagtggtcgagcttcccattgcggaaccgggtccgggtgaggtgcttgtcaaa
ctgcactactccggcgtctgccacacggatgccgccttttgcttgaactctttcagcacg
gtgccaccaactgcccaagggcagattggcggacacgaaggtgcaggcgaggttgtagca
cttggcccaggcgtcacggcaccggctgtcggctccttcgtgggcatcaaattcgccgcc
gatgcgtgcctgacatgtgacaactgcatcgagggcggcgattcgacgtgccagcagacg
caaatctcgggctatacggtgcccgggacgtttcagcgattctgcacgacccctgcacgc
tacgcgacgccgatcccgagcggactggacctcgcgtccgccgccccgctcatgtgcggc
ggcatcagcgtctacaccgcgctcaggacggcggggcttcgagtgggcgactgggtcgtc
atctcgggcgctggcggcggactgggccacctgggtgtgcagtacgccaaggcgctgggg
gcgcgcgtcgtggccgtggacgccggcgtcaaggaggcgctctgtcgcgagctcggtgcc
gacgactttgtcgacttcgcggcgtttgcgtcggacgccgacttggcggcgcgcatcaag
gaggccacgggcggcggcgcgcgcattgcgctcatgtgctcggcgagctccaagtcgtac
gggcagtgcatgtcctggctcgggttcagggggacggtcgcctgcctggggatcccggac
aaggagggcgctttgctgcccagcatcggcgacatggtgacattcgagcatcgcatcatc
gcgaccaagacgggcaaccgactcgaggcgaagcagtgtctcgagctggcagcgcagggt
cgtgtgaagacgcggtacacactgcgccgcatggagagtctgacgaacatctttgaggaa
ctcgagagtggcaagattcagggtcgtgtcgtgctcgaccttcggggcgattaa

DBGET integrated database retrieval system