KEGG   Verticillium albo-atrum: VDBG_03084Help
Entry
VDBG_03084        CDS       T02227                                 

Definition
bifunctional protein GAL10
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
val  Verticillium albo-atrum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:val00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:val00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MTDAPFEFLALGAIIQSFQVKGINIVQGFPTKELYEQHNSPFFGETIGRIANRVKNAKID
SLNGGKSYTLAANNGVNHLHGGNKGWGKREWNGPKPVGVRSIPGVDGLEGGESVQFSLLS
EDGDEGYPGSVETIITYTAGVQKQNGKEVNVLGIDYETKLVGGADETAINLTNHSYFNLT
GGPTIEGTEITLATDKPDIDDCFVVNEAAGAVPLDTRNSPLTTLVQAYHPESKVHLEVAS
TEPAFQFYTGKYIDVPAVGGLPARGKRSGFCVEPSRYVNAINVDEWRSQSVLKRGDVYGA
RIVYRGWSE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcacctttcgagttcctggccctcggcgccatcatccagtcattccaagtc
aagggcatcaacattgtccagggcttccccaccaaggagctgtacgagcagcacaactcg
cctttcttcggcgagaccatcggccgcatcgccaaccgcgtcaagaacgccaagattgac
tccctcaacggcggcaagtcctacaccctggccgccaacaacggcgtcaaccacctccac
ggcggcaacaagggctggggcaagcgggagtggaacggccccaagcccgtcggcgtgcgc
tccattcccggcgttgacggcctcgagggtggcgagagcgtgcagttctctctactcagc
gaggatggcgacgagggatacccaggctcggtcgagaccattatcacctacactgcaggt
gtgcagaagcagaacggcaaagaggtcaacgtcctgggaatcgactacgagaccaagctt
gtcggcggcgctgacgagactgccatcaacctgacaaaccactcctacttcaacctgacg
ggcggaccgacaatcgagggcaccgagatcacgcttgcgaccgacaaacccgatattgac
gactgcttcgttgtcaacgaagcggccggcgcagtccccctggacacacgcaacagcccg
ctgacaacgctcgtgcaggcgtaccacccagagagcaaggtgcatctcgaagtggccagc
acggagcccgcgttccagttctacacaggcaaatacattgacgtgccggccgttggcggg
ctgccggcgcgaggcaagcgcagcggcttctgcgttgagccgagtcgctacgtcaatgcc
atcaacgttgacgagtggaggtcgcaatcagtgctgaagaggggcgacgtctacggcgca
cgaattgtgtaccgcggctggagcgagtaa

DBGET integrated database retrieval system