KEGG   Verticillium alfalfae: VDBG_03084Help
Entry
VDBG_03084        CDS       T02227                                 

Definition
bifunctional protein GAL10
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
val  Verticillium alfalfae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VDBG_03084
   00052 Galactose metabolism
    VDBG_03084
Enzymes [BR:val01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VDBG_03084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MTDAPFEFLALGAIIQSFQVKGINIVQGFPTKELYEQHNSPFFGETIGRIANRVKNAKID
SLNGGKSYTLAANNGVNHLHGGNKGWGKREWNGPKPVGVRSIPGVDGLEGGESVQFSLLS
EDGDEGYPGSVETIITYTAGVQKQNGKEVNVLGIDYETKLVGGADETAINLTNHSYFNLT
GGPTIEGTEITLATDKPDIDDCFVVNEAAGAVPLDTRNSPLTTLVQAYHPESKVHLEVAS
TEPAFQFYTGKYIDVPAVGGLPARGKRSGFCVEPSRYVNAINVDEWRSQSVLKRGDVYGA
RIVYRGWSE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcacctttcgagttcctggccctcggcgccatcatccagtcattccaagtc
aagggcatcaacattgtccagggcttccccaccaaggagctgtacgagcagcacaactcg
cctttcttcggcgagaccatcggccgcatcgccaaccgcgtcaagaacgccaagattgac
tccctcaacggcggcaagtcctacaccctggccgccaacaacggcgtcaaccacctccac
ggcggcaacaagggctggggcaagcgggagtggaacggccccaagcccgtcggcgtgcgc
tccattcccggcgttgacggcctcgagggtggcgagagcgtgcagttctctctactcagc
gaggatggcgacgagggatacccaggctcggtcgagaccattatcacctacactgcaggt
gtgcagaagcagaacggcaaagaggtcaacgtcctgggaatcgactacgagaccaagctt
gtcggcggcgctgacgagactgccatcaacctgacaaaccactcctacttcaacctgacg
ggcggaccgacaatcgagggcaccgagatcacgcttgcgaccgacaaacccgatattgac
gactgcttcgttgtcaacgaagcggccggcgcagtccccctggacacacgcaacagcccg
ctgacaacgctcgtgcaggcgtaccacccagagagcaaggtgcatctcgaagtggccagc
acggagcccgcgttccagttctacacaggcaaatacattgacgtgccggccgttggcggg
ctgccggcgcgaggcaagcgcagcggcttctgcgttgagccgagtcgctacgtcaatgcc
atcaacgttgacgagtggaggtcgcaatcagtgctgaagaggggcgacgtctacggcgca
cgaattgtgtaccgcggctggagcgagtaa

DBGET integrated database retrieval system