KEGG   Verticillium albo-atrum: VDBG_03244Help
Entry
VDBG_03244        CDS       T02227                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
val  Verticillium albo-atrum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:val01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:val00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MSLCTSMVKSKFLDKPEDIGVVVAGFSGGQRKAGVDHGPQALIDAGLLTSLRAELGYTLH
GDDKVHSYEDIIPADDAPVRNMKNPRIAVGTIGGSARATRERLGREIAVIWVDAHADINT
PETSDSGNITACPWRLSRASPRRRKRDCFGWLQDENMLSLKKLVYIGLRDVDAGEKRILR
ENGVKAFSMHDVDRHGIGKVMDMALAHIGTDTPIHLSFDVDALDPQWAPSTGTPVRGGLT
LREGDYICECVHETGSLIAVDLVEVNPALADTEIGAAETIRAGCSLVRCALGESLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtgcacctccatggtcaagtccaagttcctcgacaagcctgaggacattggc
gttgtcgttgctggcttctctggtggtcagcgcaaggcaggtgtcgaccacggcccccag
gctctcatcgacgccggtctcctgacctcgctgcgcgccgagctcggctacaccctccac
ggcgacgacaaggtccactcgtacgaggacatcatccccgccgacgatgcgcccgtccgc
aacatgaagaacccgcgcatcgccgtcggcaccattggcggctcggcgcgcgccacgcgc
gagcgtctcggccgcgagatcgccgtcatctgggtcgacgcccacgccgacatcaacacg
cccgagacgtcggacagcggcaacatcacggcatgcccgtggcgtttgtcacgggcctcg
ccaaggaggcggaagcgcgactgcttcggctggctccaggacgagaacatgctgagcctc
aagaagctcgtgtacattgggctgcgcgacgtcgacgccggcgagaagaggatcctgcgc
gagaacggcgtcaaggcgttcagcatgcacgacgtcgaccgccacggcatcggcaaggtc
atggacatggcgctcgcgcacattggcaccgacacgcccatccacctgtcgttcgacgtc
gacgcgctcgacccccagtgggcgcccagcaccggcacgcccgtgcgcggcggcctgacg
ctgcgcgagggggactacatctgcgagtgcgtgcacgagacgggcagcctcatcgccgtc
gacctcgtcgaggtcaacccggcgctcgccgacacggagattggcgccgccgagaccatc
agggccggctgctccctcgtgcgttgcgccctgggcgagtcgctgctgtga

DBGET integrated database retrieval system