KEGG   Verticillium alfalfae: VDBG_03272Help
Entry
VDBG_03272        CDS       T02227                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
val  Verticillium alfalfae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    VDBG_03272
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_03272
Peptidases [BR:val01002]
 Metallo Peptidases
  Family M67
   VDBG_03272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MNGTSAPRPSRPTNTKELAAMGDNFEFQPTVPFKHWARSADVLYQEAGFAMQDHDYRKAY
VMLWRHSSLVLKHLDTHPDAKLPENKAFTKALRKRQANEVFRRLEQLKPLIDSEYDEWAR
MTAASKKADIEQEVLKPTTYNDFAARDPSLGGRARILDAGDNQEFAVDLAQRDFVRRDTI
KRGIRRAGVSVEQEQERRRGGAWDDWQGGQPDTTNDAEELRRQMEATRQRLDDNQGGYQR
VEDAFSHTGVSRPHPPSPPPKIPTQPYHYPSVSKPKPVHWDSAPLEPRRPDIAAPSKPPK
ELDIPPYKHDVVPPSRPLKESLPAYKRLPTPEPPAAAAPTRPPKEQEVENGDPIRPVFIP
SELRHKFLEIASGNTRKGLEMCGILCGRPINNALFISCLLIPEQKCTSDTCETENESAQL
EYCINEDLLVLGWIHTHPTQTCFMSSRDLHTQAGYQIMMPESIAIVCAPQHQPSHGIFRL
TNPPGLPHILNCNQAAMFHQHHIDNIYTKASNPPGHVFQSDKLHWYVKDLRPKN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggacatcagcaccgcggccttcgcggccgaccaacacgaaggagcttgccgca
atgggcgacaacttcgaattccaacctacagttcccttcaagcactgggctcgttcagct
gacgtcctgtatcaagaggcaggattcgccatgcaggaccacgactacaggaaagcatac
gtcatgctctggcgacactcatcgcttgtgctgaaacacctcgacacgcaccctgacgcc
aaacttccggaaaacaaggccttcacgaaggccttgcggaagcgccaggcgaatgaggtc
ttcaggcgtctcgaacaactcaaaccgctcattgacagtgaatacgacgagtgggcacgg
atgaccgctgcgtctaagaaggccgacatcgagcaagaagtcttgaaacccacgacctac
aatgattttgcagctcgtgacccctctcttggtgggagagcaagaattctggacgcaggc
gacaaccaggagttcgcggtcgacttggcgcaacgagatttcgtccggcgggacacaata
aagaggggaatccgccgtgctggtgtttcggtggagcaggagcaagagcgccggagaggt
ggtgcatgggatgactggcaaggcggacagccggataccacgaacgacgccgaagaattg
agaagacaaatggaagccactcgacaaaggcttgatgacaaccagggcgggtaccagaga
gtcgaagacgctttcagccacacaggcgtctcacgcccacatccaccatcgcctcctccc
aaaataccgacccagccgtaccattatccttccgtgtcaaaaccgaaaccagtgcattgg
gattctgccccactggagcctcgaaggccggatatcgcggcaccatcaaagcctccaaaa
gaattggacattccgccttacaaacacgacgttgtgccgccctcgaggccgctcaaggag
tctctcccggcgtacaaacgactccctacacctgaaccaccagcagcagctgcccccact
cggcctccaaaggaacaggaggtggagaatggggatcctatccggcccgttttcattccc
agcgaactgcgtcataagttccttgagattgcttcaggaaacacgcgcaagggcttagag
atgtgtggcattctgtgcggaaggccgattaataacgcacttttcatcagctgtctcctt
atccccgagcagaaatgcacatcggacacttgcgaaacagagaatgagtctgcgcaactc
gagtattgtatcaacgaggatctcttagttctcggctggattcatacacacccaacacag
acctgcttcatgagttcgcgtgatctccacacacaggcggggtaccagatcatgatgcct
gagagtattgcgatcgtctgtgccccgcaacaccagccgtcgcacggcatcttccgcctg
acgaatccgcctggcctcccgcatattctcaattgcaaccaggcggcgatgttccaccaa
catcacattgacaacatttacactaaggccagcaaccctcctggacacgtgtttcagtca
gacaagctgcattggtacgtcaaggacttgcgacccaaaaattag

DBGET integrated database retrieval system