KEGG   Verticillium alfalfae: VDBG_03338Help
Entry
VDBG_03338        CDS       T02227                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
val  Verticillium alfalfae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VDBG_03338
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VDBG_03338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 116 aa AA seqDB search
MTREERRSRKRFAVKTIADQTAKGKVVVLDIEMEGVKQVQKSDIDARYVFVAPPSADELE
RRLRGRGTESEASIQKRLTQAKVELAYAETGVHDKVIINEDLETAYKELEDFVYKA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagaggagaggcgcagcagaaaacggtttgcagtgaagaccattgccgaccag
acggccaagggcaaggtcgtcgtgctcgacattgagatggagggcgtcaagcaggtccag
aagagcgacatcgacgcccgctacgtcttcgtcgcgcccccctcggccgacgagctcgag
cgccgcctgcgcggccgcggtaccgagtccgaggcgagcatccagaagcgcctgacccag
gccaaggttgagctggcctacgccgagacgggcgtccacgacaaggtcatcatcaacgag
gacctcgagacggcctacaaggagctcgaggattttgtgtacaaggcatga

DBGET integrated database retrieval system