KEGG   Verticillium alfalfae: VDBG_03354Help
Entry
VDBG_03354        CDS       T02227                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
val  Verticillium alfalfae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    VDBG_03354
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    VDBG_03354
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     VDBG_03354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 663 aa AA seqDB search
MAGPVIPFQLLKGTWIRKVSKKNRGKRFILLLEPDAAKISWDRARPHKALYIDDIKEIRV
GSDIRQYRLDFGVPESEEPRWFSILYAVPDKSKSKMMHLIADDASVFYNWVTTLEAISKH
RQDLMSSLMAFNDRAIRDYWRTEMAKQFADKPHSPDDEDLNFQGVQDVCRKLHIHASPSQ
LRAKFHAADTPKTGRLNYFEFQTFVGYMKRRDDIRQVYLQTARAPEAGLSLNEFYDFLRN
VQGEDVDADLAGWEALYLKFTRKFKPKDAPSDNFGMSDAAFAAYLTSTYNVPLAKEPKEY
TLDRPMNEYLISSSHNTYLLGRQVAGFSSVEGYIAALARGLSETMTTINKYAFVKTRYPL
WISLEVHCNPQQQAIMARIIKETFGARLVTEPLDPTADKLPSPEELKERILIKVKKPMSK
EEPKLPEPGRRRGNSLTSPYAKPVQLDNNVIPSQSLPQSPLLSPSNSSRRLVSKSRVNTI
TEGERAPSKRNSPNKTVKVLGDLGVYCAGVKFGGFDTADAKEYNHIFSFMESSFEKHSRP
KEAKQAMDRHNMRYLMRVYPDRYRYQSTNFDPLVYWRRGVQMAAMNWQTFDLGMQLNQAM
FDSGTDRSGYVLKPSELREIQVLPEGWSGKRERKEVTFSIDVVSAQQLMRLTHGCVQDCG
PLC
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcctgtgattccttttcagcttctcaagggtacttggatccgcaaagtgtcc
aagaagaaccgggggaagcgattcatacttcttctggagccagacgccgccaagatctcg
tgggaccgagctcgtcctcacaaggccctctacatcgacgacattaaagagatcagggtc
ggctctgatattcgacaataccgactcgactttggcgtgccagaatcggaagagccccgc
tggttctctattttgtacgccgtgcccgacaagtccaagagcaaaatgatgcatctcatt
gccgatgatgccagtgtcttctacaactgggtcaccaccctagaggccatttcgaagcat
cgccaggatctcatgtcctcgctcatggccttcaatgaccgggcgatccgcgactactgg
cgcaccgagatggccaagcagttcgctgataagcctcactcccctgacgacgaagatctc
aactttcaaggcgtccaggacgtctgtcgaaaattgcacatccatgcgtcgcccagccag
cttcgcgcaaagttccatgcagctgacacccccaagaccggtcgccttaactactttgag
tttcaaacattcgtcggctacatgaagaggagagacgatattcgtcaagtatacctacag
acggcgagggctcccgaggccggcctctcgctgaacgagttctatgacttcctgcgcaat
gtacagggggaggatgttgatgccgacctcgccggatgggaggcattgtatctcaagttc
acccgcaagttcaagcccaaggacgcgccatcggacaattttggcatgagtgatgccgcc
ttcgctgcttatctcacttcgacatacaacgtccccctggccaaggagcccaaggagtat
actctggatcggcccatgaacgagtaccttatctcgagctctcacaacacgtacctcttg
ggaagacaagtggcagggttctctagcgttgagggctatatcgctgccctcgcacgaggg
ctgtcggaaaccatgacgaccatcaacaagtacgcgtttgtcaagacgcgttacccgctc
tggatttctcttgaggtgcactgcaacccgcaacagcaggctatcatggcacgaatcatc
aaggagacctttggggcccgcctcgtcacagaacccctggatcctacagctgacaagctt
ccttctcctgaggagcttaaggagcgtatcctgatcaaggtcaagaagcccatgtcgaag
gaggagccaaaactccccgaacccggccgcaggcgtggcaacagcctcacgtcgccctat
gcgaaacctgttcaactagacaacaacgtcatcccgtctcagtcgcttccgcaaagccca
ctcctcagcccaagcaactcgtcgcgccgcctggttagcaagagccgtgtcaacaccatc
actgagggcgagagggcaccatcgaagcggaattcacccaacaagacggtcaaggtcctc
ggcgatcttggtgtctactgcgcgggtgtcaagtttggcgggttcgacacagctgacgcg
aaggagtacaaccacattttttccttcatggaatcgagctttgaaaagcacagcaggccc
aaagaggcgaagcaggccatggaccgacacaacatgcgctacctgatgcgagtttaccct
gatcgataccgataccagtcgaccaactttgatcctctagtctactggcgaaggggcgtg
cagatggccgccatgaactggcagacattcgacttgggcatgcaactcaaccaggccatg
ttcgacagcggtactgatcggtccggatatgtcctcaagcctagcgagcttcgtgaaatc
caagtgctccctgaaggctggtccggcaaacgcgagcgcaaggaggttaccttcagcatc
gatgtcgtctccgcccagcagctgatgcgcctaacgcatggctgcgtccaagactgtgga
cccctttgttga

DBGET integrated database retrieval system